KEGG   Cyanothece sp. PCC 8801: PCC8801_0864Help
Entry
PCC8801_0864      CDS       T00806                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
cyp00790  Folate biosynthesis
cyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCC8801_0864
Enzymes [BR:cyp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PCC8801_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACK64942
UniProt: B7JYS2
Position
905167..905811
Genome map
AA seq 214 aa AA seqDB search
MTLSQPKELNPTLPKLITQSQPPVTEEEMRQAVRTLLLGLGEDPDREGLRDTPKRVVKAL
KFLTSGYHQSLDELLNGAVFHENTDEMVLVRDIDLFSSCEHHILPILGRAHIAYIPDGKV
IGLSKIARICEMYGRRLQVQERLTAQIADALQGLLQPKGVAVVVEATHMCMVMRGVQKAG
SWTVTSAVRGLFAEDAKTRQEFMSLIRHSATFHH
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgactctatcccaacccaaagaactgaatcctactttacccaagctgatcacccaatct
caaccccctgttaccgaagaagagatgcgtcaggccgttagaaccctactcttgggacta
ggggaagaccctgaccgcgaagggctcagagataccccgaaacgagtggttaaagcactg
aaatttctcacctctgggtatcaccaatctctggatgaactactcaatggagcagtattc
cacgaaaatactgacgaaatggtattagttagggatattgacctgtttagttcctgtgag
caccatattctcccgattttaggtcgagcacacattgcctatattcccgatggtaaagtg
attggtctgtctaaaattgcacgaatttgtgaaatgtatggacgacggttacaggtgcaa
gaacgactgaccgcacaaattgccgacgcattacaggggttactacaacccaaaggggtg
gccgtggttgtagaagcaacccatatgtgtatggtcatgcgtggggtgcaaaaagcgggc
tcttggacagttaccagtgcagtgcggggactgtttgcagaagatgccaaaactcgtcaa
gaatttatgagtttaattcgtcattctgctacctttcatcattaa

DBGET integrated database retrieval system