KEGG   Rippkaea orientalis PCC 8801: PCC8801_1195Help
Entry
PCC8801_1195      CDS       T00806                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
cyp  Rippkaea orientalis PCC 8801
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PCC8801_1195
Enzymes [BR:cyp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     PCC8801_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACK65262
UniProt: B7K2C6
Position
complement(1243066..1243884)
Genome map
AA seq 272 aa AA seqDB search
MKSYLAAAIQMTSKPNLEENLAEAEELIELAVRRGAELIGLPENFAFLGQEEDKLKQAQT
IDLEAEKFLKKMAQRFQITILGGGFPVPVQGDPTKAYNTAILVEPNGTEVARYQKAHLFD
VDVPDGNTYRESSTVMSGKALPNVYHSEQLGNLGLSICYDVRFPELYRHLSRQGADVIFI
PAAFTAFTGKDHWQVLLQARAIENTCYVIAPAQTGNHYERRYTHGHACIVDPWGTILADA
GEQPGMAIAEINPTRLKQVRQQMPSLQHRIFV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctatctcgctgctgccattcaaatgacgagcaagcctaacctcgaagaaaac
ttggctgaggctgaagaactaattgaacttgccgtccgtcgaggggccgaattaattgga
ctgccagaaaattttgcttttttgggtcaagaagaagataaattaaagcaagctcaaacg
attgacttagaagcggaaaaattcctcaaaaaaatggcgcaacgcttccagatcacaatt
ttggggggtggtttccccgtccccgtccaaggtgatcccaccaaagcctataatacggcc
attttagtcgaaccgaacggaaccgaagtcgcccgttatcaaaaagcacacctctttgat
gtggatgtccccgatggtaacacctatcgggagtccagtaccgtaatgtctggaaaagcg
ttaccaaacgtttatcattccgaacaattaggtaatttaggactatctatttgctatgat
gtccgctttcctgaactctatcgtcatttatctcgtcaaggggcagatgttatctttatt
ccggcagcttttaccgcttttacgggcaaagatcactggcaagtgttgctacaagcgagg
gcaattgaaaacacctgctacgtcattgcgccagcgcaaacgggcaatcattacgaacgg
cgttatactcacggtcatgcctgtattgtagacccttgggggacaattttagccgatgcg
ggggaacaacccggaatggcgatcgcagaaattaatcctactcgtcttaagcaagttcgt
caacaaatgccctctttgcaacatcgcatcttcgtctaa

DBGET integrated database retrieval system