KEGG   Cyanothece sp. PCC 8801: PCC8801_1478Help
Entry
PCC8801_1478      CDS       T00806                                 

Definition
(GenBank) precorrin-6y C5,15-methyltransferase (decarboxylating), CbiE subunit
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
cyp00860  Porphyrin and chlorophyll metabolism
cyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC8801_1478
Enzymes [BR:cyp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     PCC8801_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Methyltransf_4 MTS Met_10 Methyltransf_31 GidB Methyltransf_18 Methyltr_RsmB-F Methyltransf_25 Methyltransf_15 PrmA Methyltransf_2 Cons_hypoth95
Motif
Other DBs
NCBI-ProteinID: ACK65534
UniProt: B7JUJ0
Position
1553602..1554858
Genome map
AA seq 418 aa AA seqDB search
MINVVGIGLDGVIGLTEKVRLMVEESTVIVGSKRHLSYFPSYLGKKLVLDDFSEAIQAIK
NYHKSDIVIVILVSGDPLFFGLGRLLLEHFSTEELEFFPHLSCIQLAFNRLKIPWQDAKI
ISVHGRELEELIPLFKQGVDKIAILTDDNNNPPAIARLYLSLDLPSHYDFWIGEDLGDAT
EKISHYSPQDLSKQPDHLFSALNVVILIRNTVDQLSLIDLENLPLFGLSDHLFLSFPDRP
GLMTKREIRLTILGELALEKQQIIWDIGAGTGSVSIEIARLSPNSTIYAIEKTAMGITLI
NQNCQRFQVSNVIPVSGKAPDILTELPQPHRIFIGGSGGHIYTILEICQAKLRENGMIVM
ALATLENLALSLDWFKVHPWDYQVLEMLISRSVAVNNLTRFSPLNPVMLIKATKKSLR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgattaacgttgtcggaattgggttagatggggttataggattaaccgaaaaggttaga
ttaatggttgaagaatcaaccgttatcgtaggaagtaaacgacatttaagttattttcct
agttatttgggtaaaaaattagttttagatgattttagtgaagcaattcaagccattaaa
aattatcataaatctgatatagttattgttattttagttagtggtgatcccctatttttt
ggattaggaagattattgttagaacatttttccacagaagaattagaattttttccccat
ctaagttgtattcaattagcctttaatcgtctaaaaataccctggcaagatgctaaaata
attagtgttcatggaagagaattagaagagttaatccctctttttaagcaaggggttgat
aagattgctattttaactgatgataataataatcccccggcgatcgctcgtctttattta
agcttagatttaccttcccattatgacttctggataggtgaagatttaggagatgcgact
gaaaaaatcagtcattattctccgcaagatttatcaaaacaacccgatcatctgttttca
gctctaaacgtcgttattttaatccgaaatacagtcgatcaactgtctttaatagatctc
gaaaatctaccgctattcggtttatccgatcacttatttttaagttttccagatcgtcca
gggttaatgacaaagagagaaatacgattaacaattttaggagaattagccctagaaaaa
caacaaattatttgggatattggtgcaggaaccggttctgtgtctatagaaattgccaga
ctgtctcctaattcaacaatttatgccattgaaaaaactgcaatgggcatcaccttaatt
aaccaaaattgtcagcgttttcaagtctctaatgtgattcccgtatcaggaaaagccccc
gatattttaacagaattaccccaaccccatcgcatttttatcggaggaagtggcggacat
atatacacaattttagagatttgtcaagccaaattaagggaaaatggaatgatagtgatg
gccttagcaaccctagaaaatttagccctaagtttagactggttcaaagttcatccgtgg
gattatcaggtattagaaatgctaatttctcgctcagttgcagtgaataatttaacgcga
ttttctcccttaaatcccgtcatgttaattaaagcaacgaaaaaaagtttaagatag

DBGET integrated database retrieval system