KEGG   Cyanothece sp. PCC 8801: PCC8801_1490Help
Entry
PCC8801_1490      CDS       T00806                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
cyp00260  Glycine, serine and threonine metabolism
cyp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyp01100  Metabolic pathways
cyp01110  Biosynthesis of secondary metabolites
cyp01130  Biosynthesis of antibiotics
cyp01230  Biosynthesis of amino acids
Module
cyp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC8801_1490
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PCC8801_1490
Enzymes [BR:cyp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PCC8801_1490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Ribul_P_3_epim ThiG NanE TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ACK65546
UniProt: B7JUK2
Position
1567535..1568338
Genome map
AA seq 267 aa AA seqDB search
MTSVSDCFQSLRDRRQCALIPFITAGDPDLETTAKALRLLDASGADLIELGVPYSDPLAD
GPVIQAAATRALGRGVKLEDVLGVVKEVSPEIKAPIILFTYYNPIFYRGVEAFLQQVKAA
GVQGLVVPDLPLEEAESLLKPAHEVGIAVTLLVAPTSPIERIEAIARQSQGFIYLVSVTG
VTGMRSQVTSRVKELLTSLRSATDKPIGVGFGISKPEHALQVKNWGADAVIVGSAMVKRL
AEGTPEEGLKAIGAFCQDLKQALKEDQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagtttcggattgtttccaatctctgcgcgatcgcagacaatgcgccttgatt
ccctttattacggcgggtgatcctgatttagagacaaccgccaaagccctgcggttactg
gatgcgtcaggggcagatctgattgaattaggtgttccctattctgatcccttagctgat
ggtccggtgatccaagcggcggctactcgcgccttaggtaggggggtaaaattggaagat
gtcttaggggtggttaaggaggtttctcctgagattaaggctccaattattctatttact
tactacaatccgattttttatcgcggtgtggaagcctttttgcaacaggtgaaagcagca
ggagtccaaggcttagttgtccctgatttgcccctagaagaagccgagagcctcttaaaa
cccgcccatgaggtggggatagcagtgaccctcttggtagccccgacgagtccaatagaa
cgcatcgaagcgatcgctcgtcaatcccaaggatttatctacttagtgagtgttacgggg
gtcacggggatgcgatcgcaggtaactagtcgcgtcaaagaattgctgacgagtctgcgg
agtgccacggataaacccattggggtaggttttggtatttccaaaccggaacacgcccta
caggtcaaaaattggggtgcagacgcggtgattgtgggtagtgcgatggttaaacgctta
gcggaaggaacccccgaagaaggattgaaggctattggtgcattttgtcaggatttgaaa
caagcactcaaagaggatcaataa

DBGET integrated database retrieval system