KEGG   Rippkaea orientalis PCC 8801: PCC8801_2188Help
Entry
PCC8801_2188      CDS       T00806                                 

Definition
(GenBank) Nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
cyp  Rippkaea orientalis PCC 8801
Pathway
cyp00230  Purine metabolism
cyp00240  Pyrimidine metabolism
cyp01100  Metabolic pathways
cyp01110  Biosynthesis of secondary metabolites
cyp01130  Biosynthesis of antibiotics
Module
cyp_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cyp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
cyp_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PCC8801_2188
   00240 Pyrimidine metabolism
    PCC8801_2188
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cyp04131]
    PCC8801_2188
Enzymes [BR:cyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     PCC8801_2188
Membrane trafficking [BR:cyp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    PCC8801_2188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK PSI_PsaJ
Motif
Other DBs
NCBI-ProteinID: ACK66216
UniProt: B7K069
Position
complement(2263364..2263795)
Genome map
AA seq 143 aa AA seqDB search
MIKPDGVQRGLVGEVISRFEAKGFTLVGMKLMQVSKELAEKHYDVHKERPFFKGLVEFIS
SSPVVAMVWEGDGVVASARKLIGATNPLTAEPGTIRGDYGVSVGRNLIHGSDAIETAQTE
INLWFSSEELASWQPTMTPWLYE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaccagacggagtacaacgcggtttagtcggcgaagtcattagtcgttttgaa
gctaaagggtttacccttgtgggcatgaagctaatgcaagtctcaaaggaattggcggaa
aaacactatgatgtccacaaagaacgccccttttttaaaggtttagtcgaatttatctct
tcttcccctgtggtagcgatggtttgggaaggagacggtgtggtagcctctgccagaaaa
ttgatcggggctactaaccccttaacggcagaacctggaaccattcgcggtgattatggg
gtgagtgtgggacgcaatttaattcatgggtctgatgccattgaaactgcccaaacagag
attaatctttggtttagtagtgaagaattagcttcttggcaaccaacgatgactccttgg
ctgtacgaatag

DBGET integrated database retrieval system