KEGG   Rippkaea orientalis PCC 8801: PCC8801_3007Help
Entry
PCC8801_3007      CDS       T00806                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
cyp  Rippkaea orientalis PCC 8801
Pathway
cyp00220  Arginine biosynthesis
cyp01100  Metabolic pathways
cyp01110  Biosynthesis of secondary metabolites
cyp01130  Biosynthesis of antibiotics
cyp01230  Biosynthesis of amino acids
Module
cyp_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PCC8801_3007
Enzymes [BR:cyp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     PCC8801_3007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Methyltrans_RNA
Motif
Other DBs
NCBI-ProteinID: ACK66994
UniProt: B7JWE9
Position
complement(3116038..3116967)
Genome map
AA seq 309 aa AA seqDB search
MSMNTLKGRDILGIADLSASELTEILELGALLKSGERSPVCQKVLGLLFSKASTRTRVSF
SVAMYQLGGQVIDLNPSVTQVGRGEPLIDTARVLDRYLDILAIRTYQQEDLETFAKYAKI
PIINALTDWEHPCQILADLMTIKECFGTLSGITVTYLGDGNNVAHSLILGGALMGMNVHI
ATPKDYQPNQAILDKAKEIGVEGFQVLVTDNPIEAVEGSQVLYTDVWASMGQESSAEARI
PLFEPYQVNQKLLNHADQEAIVLHCLPAHRGEEITDEVIEGKQSRVWDQAENRMHAQKAL
MVSLLGVDS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgaatacgttaaaaggacgagatattctaggtattgctgatttaagtgcttct
gaattgacagaaatacttgaattaggggctttgctcaaaagtggagagcgatcgcctgtg
tgtcaaaaagtcctaggactgctcttttctaaagcgtctactcgtactcgtgtctccttt
agtgtagccatgtatcaattagggggtcaagtgatcgatttgaaccccagtgttacgcaa
gtgggaaggggagaacccctgattgatactgcaagagttttagatcggtatttagatatt
ctcgctattcgcacctatcaacaagaagacttagaaacgtttgcaaaatatgccaaaatt
ccaattattaatgccttgactgattgggaacatccttgtcaaattttagccgatttaatg
accatcaaagagtgttttggaaccctctctggaataacagttacttacttaggagatggg
aataatgttgcccattcgttaattttaggaggagcattaatgggaatgaatgttcatatt
gctacccccaaagattatcaacccaatcaagccattttagacaaagccaaagaaattggg
gttgaaggatttcaagtattagtaaccgataatcccatagaagctgtagaagggtcacaa
gtcctttatactgatgtttgggcaagtatgggacaagaatcatccgccgaagccagaatc
cctttatttgaaccctatcaagtgaatcaaaaattactgaatcacgctgatcaagaagcg
attgtgttacactgtttacccgcccatcgaggggaagaaattaccgatgaagtgattgaa
ggaaagcagtcacgggtatgggatcaagccgaaaatagaatgcacgctcaaaaagcattg
atggttagtttattaggagttgatagttaa

DBGET integrated database retrieval system