KEGG   Rippkaea orientalis PCC 8801: PCC8801_3439Help
Entry
PCC8801_3439      CDS       T00806                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
cyp  Rippkaea orientalis PCC 8801
Pathway
cyp00740  Riboflavin metabolism
cyp00790  Folate biosynthesis
cyp01100  Metabolic pathways
cyp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PCC8801_3439
   00790 Folate biosynthesis
    PCC8801_3439
Enzymes [BR:cyp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     PCC8801_3439
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     PCC8801_3439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ACK67407
UniProt: B7K0C3
Position
complement(3584458..3586128)
Genome map
AA seq 556 aa AA seqDB search
MDASPNAIAQFDTIDAALADIKAGKAIIVVDDENRENEGDLICAAQFATPNMINFMAVEA
RGLICLAMMGERLDTLDLPLMVTKNTDSNQTAFTVSIDAAKHLGVSTGISAEDRARTIQV
AINPDTHPDDLTRPGHIFPIRAKEGGVLKRAGHTEAAVDLSRLAGLYPAGVICEIQNPDG
SMARLPELFEYAKKHELKLISIADLISYRLKHDRFVYRETVCQFPSQFGTFQLYAYRNVL
DGTEHVAIVKGDPAQFKDQPVMVRMHSECLTGDALGSMRCDCRMQLQTALKMIEGSGLGV
VVYLRQEGRGIGLVNKLKAYSLQDMGLDTVEANERLGFPADLRDYGMGAQMLNDLGVKQI
RLITNNPRKIAGLKGYGLEVVDRVPLLIEANDYNANYLATKAEKLGHLLLHTYLITVAID
WETEMRSAKERYGNLEKLRQLCRSSQLLLQEEVRPIANALFSSPSLIFHLGFEQGKMVDP
HWYHNSKHPYLSAIAQILDEIVTWPNIKRLEFLISSGDDPLLGLQVQLDRHTFSLKDQPS
EYLRELEMQTIYSFQG
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
gtggatgcttcacccaacgcgatcgctcaatttgacaccattgatgctgctttagctgat
attaaagcaggaaaggctattatcgttgtcgatgacgaaaatcgagaaaatgaaggggat
ctcatctgtgcagctcaatttgccacccctaacatgattaattttatggcggttgaagcc
agagggctcatttgcctagccatgatgggagaacgcctcgataccctcgatcttccccta
atggtgacaaaaaacaccgatagtaaccaaaccgcttttaccgttagcatcgacgcggct
aaacatttaggggttagtacgggtatttccgccgaagatcgtgctcgtaccattcaagtc
gccattaaccccgatacccaccccgacgacctaacccgtcctggccatatcttccccatt
cgtgctaaagaaggaggtgtcctcaaacgtgcgggtcataccgaggcagccgttgattta
tcgcgcttagcggggctctatccggccggggtcatctgcgaaattcaaaaccccgatggt
tcgatggcgcgactccctgaactgttcgagtacgccaaaaaacacgaactcaaattgatt
agtattgcggacttaattagttaccgtttgaaacatgatcgcttcgtctatcgggagacg
gtctgtcaatttcccagtcaatttggcacatttcaactctatgcttatcggaatgttctt
gatggaacggagcacgtcgctattgttaaaggagatccggcacagtttaaagatcaaccc
gttatggtacggatgcactcagaatgtttaacgggggatgctcttggatcgatgcgctgt
gactgtcgtatgcagctacaaacggctttaaaaatgattgaagggtctgggttaggggtg
gtggtctatctgcgtcaggaagggcgaggaattggactggtgaataagttaaaagcctat
tcgttgcaggatatgggactcgatacggtggaagccaatgaaagattaggatttccggcg
gatttgcgcgattatgggatgggggcgcaaatgttaaatgatttaggggttaaacaaatt
cgcctaattaccaataatcctcgaaaaattgccggattaaaagggtatggtttggaggtg
gttgatcgggttccgttgttaattgaagccaatgattataatgcaaattatttagccacc
aaagccgaaaaattaggacatttactattgcatacctatttaattacggtggccattgat
tgggaaacagagatgcgaagtgccaaggaacgctatggaaatttggaaaagttacgccaa
ttatgtcgttcttctcaattattattacaagaagaagttagaccgatcgctaatgcgttg
tttagtagtccgagtttgatttttcatttagggtttgaacagggaaaaatggtcgatccc
cattggtatcataatagtaaacatccttatttgagtgcgatcgcgcaaatcttagatgaa
attgtcacttggccgaatattaaacgcttagaatttttgatttcttccggggatgatccc
ttgttgggattacaagtccaattagatcgtcatacgttttctttgaaggatcaaccttct
gaatatttacgagaattagagatgcaaacgatctatagttttcaggggtga

DBGET integrated database retrieval system