KEGG   Cyanothece sp. PCC 8801: PCC8801_3489Help
Entry
PCC8801_3489      CDS       T00806                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
cyp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyp01100  Metabolic pathways
cyp01110  Biosynthesis of secondary metabolites
cyp01130  Biosynthesis of antibiotics
cyp01230  Biosynthesis of amino acids
Module
cyp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PCC8801_3489
Enzymes [BR:cyp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PCC8801_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACK67454
UniProt: B7K0H0
Position
complement(3644065..3644946)
Genome map
AA seq 293 aa AA seqDB search
MQIRRRSPNPPVEVDTLRYQVKVPDGEPRHILEEIVWHKEKEVDRLRESLPLLELRKQVQ
HLPPPQDFLGAITQGKTQPALIAEVKKASPSKGVIREDFDPVAIAQAYVKGGASCLSVLT
DAKFFQGSFENLALVRQSVDLPLLCKEFILYPYQIYLARTKGADAVLLIAAILSDRDLSY
FLKIIQTLGMTALIEVHSLTELDRVLAIEGVSLIGINNRNLETFEVDLKTTSQLLAARRD
KIQALGIKIISESGLHTPDDLQFVQQAGSDGVLIGESLVKQPDPTQAIANLFG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccgaagacgttctcccaatccacctgttgaagttgacaccctacgctaccaa
gtcaaggttcctgacggtgaacctagacacatcctcgaagaaattgtctggcataaagaa
aaagaagtcgatcgcctccgagaaagtcttcccctgctagagttacgaaaacaagtccaa
catctgcccccaccacaggactttttaggggcgatcacccaaggcaaaacccaaccggcc
ttaattgcagaagtcaaaaaagcctcccccagtaaaggagtgattcgagaagatttcgat
cctgttgccattgcccaagcgtacgttaaaggaggggcaagttgtttgtctgtcctcacc
gatgctaagttttttcaaggtagctttgagaacctcgccttagttcggcaaagcgtcgat
ttacccctgctgtgtaaagaatttatcctctatccctatcaaatctatttagcgcggaca
aaaggggcagatgcggtattattgattgcagctatattaagcgatcgcgatctcagctat
ttcctcaaaattattcaaacattggggatgacagccctaattgaagtccattccttaacc
gaactcgatcgcgtcttagccatcgaaggggtatccttgatcggtattaataaccgcaat
ttagaaacctttgaggtagatctcaagaccactagccaattattagcagcccgacgggac
aaaatccaagccttggggattaaaattatcagtgagtcaggattgcatacccctgacgat
ctacaattcgtccaacaggccgggtctgatggggtgttaattggggaatctttggttaaa
caacctgatcctacccaagcgatcgccaatttatttggttaa

DBGET integrated database retrieval system