KEGG   Cycloclasticus sp. P1: Q91_0593Help
Entry
Q91_0593          CDS       T02265                                 

Gene name
tesA
Definition
(GenBank) GDSL-like lipase/acylhydrolase
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.2.2 3.1.1.2 3.1.1.5]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Q91_0593 (tesA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cyq01004]
    Q91_0593 (tesA)
Enzymes [BR:cyq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.2  arylesterase
     Q91_0593 (tesA)
    3.1.1.5  lysophospholipase
     Q91_0593 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     Q91_0593 (tesA)
    3.1.2.-  
     Q91_0593 (tesA)
Lipid biosynthesis proteins [BR:cyq01004]
 Fatty acid synthase
  Component type
   Q91_0593 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL OSK B12-binding
Motif
Other DBs
NCBI-ProteinID: AFT66631
UniProt: K0C4G5
Position
complement(602706..603212)
Genome map
AA seq 168 aa AA seqDB search
MPIEKGWVNLLQQTLNEQNKPYTLINKSISGDTTAGGLARIDQALEQHTPEIVLLELGAN
DGLRGMPPTLIKKNLRELVKRIKANGAQTLLLSMRIPSNYGQRYTEMFYNNYPELAEEMD
VPFVPFILEDVALEPDMMQADQLHPNEKAQPIIAQKIWDHLEPILQTN
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagaaaaaggctgggttaacctattacaacaaacacttaacgaacaaaacaag
ccctacacacttataaataaaagtattagtggtgacaccaccgcaggcgggcttgcccga
attgaccaagccttagaacaacatacacccgaaatagttctattagaattaggtgcaaat
gatggcttgcgtgggatgcctcccaccttaatcaagaaaaatttacgagaactcgtcaaa
cgaatcaaagccaacggtgcgcaaaccctcttgcttagcatgcgtattccatcaaattat
gggcaacgctacaccgaaatgttctacaacaactacccagagttggccgaagaaatggac
gttccttttgtgccatttattttagaggatgtcgcactcgaacccgacatgatgcaagcc
gatcaattacatccaaatgaaaaagcccagccaattattgcacaaaagatttgggaccac
ttggaacccattttacagactaattaa

DBGET integrated database retrieval system