KEGG   Cycloclasticus sp. P1: Q91_0877Help
Entry
Q91_0877          CDS       T02265                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Q91_0877
Enzymes [BR:cyq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Q91_0877
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Q91_0877
    1.1.1.-  
     Q91_0877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFT66915
UniProt: K0C329
Position
915433..916464
Genome map
AA seq 343 aa AA seqDB search
MKAAMLLGNQSIEIKEIAEPTPEANEVILKVGYTGICGTDLHEYQAGPMFAKANVVLGHE
TAGTIVACGNMSNKFSIGSRVTVIPMDYCGQCHYCVHGLYHLCEQPGWVGFTRNGAFAPY
VAVPERLLVALPEDVSLEVGALTEHFAVAFHAVRRARLQVGERILILGAGPLGLAVMQCA
LAAGASDVLVTETNKLRLETASSLGATQVYNPVEEGAEERVMQRTGGIGVDVVFDCAGTQ
KALELGFSCLRKRGRFIEMSAWGEVAKINTNNSLLAEHEIIFMFGYEMHDDFPAVLGLMA
RGVIDAGKQITKKISLDEIVKEGILPLVNGTGEEVKVLVDPAR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgatgttactggggaaccagtcgatagaaataaaagaaatagctgagccg
acacctgaggcaaatgaagttattttgaaagttggttatacgggtatttgtggtacagac
ttacacgagtaccaggcggggcccatgtttgcaaaagctaatgtagtgcttgggcatgaa
acggccggaaccattgttgcttgtggaaatatgagtaataaattctctattggcagccgg
gtcactgttattccaatggattattgtggacagtgtcattactgcgttcatggtttatat
cacctttgtgagcaaccgggttgggttgggtttacgcgaaatggcgcgtttgctccttat
gttgcagtcccagaacgtttgcttgttgctttaccagaagatgtgtctcttgaagttggc
gcacttacagaacattttgctgttgcttttcatgctgtaagaagggctaggttgcaagtg
ggcgaaagaattttaatcctaggtgcaggtcctttaggcttagctgtcatgcaatgtgca
ttagccgctggtgcatcggatgtattggtcacagaaacaaataagttaaggttagaaaca
gccagctcgctaggtgctacacaggtatataacccggtagaagagggtgctgaagaacga
gtcatgcaacgaacaggagggattggtgttgatgtggtctttgactgcgcgggaactcaa
aaggcccttgaacttggttttagctgtttacgtaagcgagggcgttttattgaaatgtcg
gcttggggtgaagttgccaagattaacactaataatagtttgttagccgagcatgaaatt
atctttatgtttgggtatgagatgcacgatgactttccggcagttttgggcttaatggct
cgcggtgttattgacgctggcaagcagataaccaagaaaatttcactggatgaaattgta
aaagagggaatattgcctcttgtaaacggcacgggagaagaagttaaagtactagtggac
ccggctaggtaa

DBGET integrated database retrieval system