KEGG   Cycloclasticus sp. P1: Q91_1083Help
Entry
Q91_1083          CDS       T02265                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00260  Glycine, serine and threonine metabolism
cyq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01130  Biosynthesis of antibiotics
cyq01230  Biosynthesis of amino acids
Module
cyq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q91_1083 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q91_1083 (trpA)
Enzymes [BR:cyq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Q91_1083 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AFT67121
UniProt: K0C5Y0
Position
1142858..1143670
Genome map
AA seq 270 aa AA seqDB search
MSRLDKCFKGLEGAKQKALIPFITAGDPDADFTLSCMHNMVKAGASIIELGVPFSDPMAD
GPVIQQASERALAKGMSLKGVIEIVRAFRETDQVTPVILMGYLNPIEFMGYETFASTAAK
AGVDGVLTVDIPPEESSDLIAAFKQHGLAPIFLLSPTSNESRIKKVSAVAQGYIYYVSLK
GVTGAGHLQLDDIKTKIQNIKQYTSLPIAIGFGVKNADIAANIAKIGDAVVVGSALINCI
TDHSENQSKGQQAISGLLSEMRTAMDAVTK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtttagacaagtgctttaaaggactcgaaggtgccaagcaaaaagctttaatt
ccctttattactgcgggtgatccagatgctgattttactctatcttgcatgcataacatg
gttaaagctggagccagcattattgaactaggcgttcctttttctgacccgatggccgat
ggccctgttattcaacaagccagtgaaagggcgttggcaaaaggaatgtctttaaaaggg
gttatagagattgttcgggcatttcgagaaactgatcaagtaacaccggttattttaatg
ggctatttaaatccgattgaatttatgggttatgaaacctttgccagtactgctgcgaaa
gctggtgttgacggcgtgttaactgttgatattcctcctgaagaaagctccgatttaata
gcagcgtttaaacagcatggtttagcgcctatattcctcttatcaccaaccagtaatgag
agtcgtatcaaaaaggtgtcagctgttgcgcaaggttatatttattatgtgtctttgaaa
ggcgtaaccggtgcggggcaccttcaactagacgacattaaaacaaaaatacaaaatatc
aaacaatacacatcattgcctatagccattggttttggtgttaaaaatgccgatatcgcc
gcgaatattgctaaaataggtgatgctgtcgtggtggggagtgcgttgattaactgcatt
accgatcactctgagaatcaatcgaaagggcaacaagccatttctggtttattaagtgaa
atgcgaacggcgatggacgctgtcacaaaataa

DBGET integrated database retrieval system