KEGG   Cycloclasticus sp. P1: Q91_1157
Entry
Q91_1157          CDS       T02265                                 

Definition
(GenBank) Dihydrodipicolinate synthetase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00626  Naphthalene degradation
cyq01100  Metabolic pathways
cyq01120  Microbial metabolism in diverse environments
cyq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    Q91_1157
Enzymes [BR:cyq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     Q91_1157
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AFT67194
UniProt: K0C1K8
Position
1229592..1230590
AA seq 332 aa
MARRQDRLTVEDVNGAWAIIPTPAIETGDQWQTEDSVDYDEIARAVDGLIESGVDAIMSQ
GTFGEGATLTWEEKKKMMEVMVETSAGRVPIFVGVTTMNTRETIRQLRHARDIGADGTML
GLPMWQQIDVPAAVRFYQDVAEAVPEMAIAIYANPEAFKFDFPAPFWAQVANIPQVITCK
YINIGQLHLHTMVSKKQIRFLPLEIDHADAAKMDPEFNTAFWSPLACTGPELTIHWRDSV
REAAKTGDWSRPDELYPQMALALSSLFPPGGFAEFSKYNIQLEKARINAAGWMKAGPCRP
PYMTAPEHYLEGAAKSGTGWAELNKKLLEGTL
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctagaagacaagacaggttaacagtagaagatgtgaatggtgcttgggcaatcatt
cctacaccagcgatagaaactggtgatcaatggcaaacagaagacagcgttgattatgac
gaaatcgctagagctgttgacggccttattgaatctggtgttgacgccatcatgagtcaa
ggaacttttggagaaggcgctacccttacttgggaagaaaagaaaaaaatgatggaagtc
atggttgaaacttcagccggacgagtacctatctttgttggtgttacaacaatgaatact
cgcgagactattcgtcaattacgtcatgcacgagatattggtgctgacggaacaatgtta
ggcttaccaatgtggcagcaaattgatgtacctgcagctgttcgtttctatcaagatgtt
gctgaagctgtgcctgaaatggcaatcgctatttacgctaacccagaagcatttaaattt
gatttcccagctccattttgggctcaagttgctaacattccacaagtcatcacttgcaag
tacataaatattggtcaactacacttgcacacgatggtttcaaaaaagcaaattagattt
ttgccactagaaatcgatcacgcagatgctgctaaaatggatccagaattcaacactgct
ttttggtcaccacttgcttgtacaggccctgagctaaccattcattggcgtgacagtgtt
agagaagcggctaaaacaggtgactggagtagaccagacgagctttacccacaaatggca
ttagcactgtctagcttattccctcctggaggctttgctgaattttctaaatataacatt
cagttagaaaaagcgcgtattaatgcagctggttggatgaaagcaggtccatgccgccct
ccttacatgacagcaccagagcactatttagaaggcgctgctaaatctggtacaggttgg
gctgagttaaataaaaaattacttgaaggcacgctttaa

DBGET integrated database retrieval system