KEGG   Cycloclasticus sp. P1: Q91_1233Help
Entry
Q91_1233          CDS       T02265                                 

Definition
(GenBank) acetyl-coa acetyltransferase protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00071  Fatty acid degradation
cyq00072  Synthesis and degradation of ketone bodies
cyq00280  Valine, leucine and isoleucine degradation
cyq00310  Lysine degradation
cyq00362  Benzoate degradation
cyq00380  Tryptophan metabolism
cyq00620  Pyruvate metabolism
cyq00630  Glyoxylate and dicarboxylate metabolism
cyq00640  Propanoate metabolism
cyq00650  Butanoate metabolism
cyq00900  Terpenoid backbone biosynthesis
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01120  Microbial metabolism in diverse environments
cyq01130  Biosynthesis of antibiotics
cyq01200  Carbon metabolism
cyq01212  Fatty acid metabolism
cyq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q91_1233
   00630 Glyoxylate and dicarboxylate metabolism
    Q91_1233
   00640 Propanoate metabolism
    Q91_1233
   00650 Butanoate metabolism
    Q91_1233
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Q91_1233
   00072 Synthesis and degradation of ketone bodies
    Q91_1233
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q91_1233
   00310 Lysine degradation
    Q91_1233
   00380 Tryptophan metabolism
    Q91_1233
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q91_1233
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q91_1233
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q91_1233
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cyq04147]
    Q91_1233
Enzymes [BR:cyq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Q91_1233
Exosome [BR:cyq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q91_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFT67270
UniProt: K0C428
Position
1309672..1310853
Genome map
AA seq 393 aa AA seqDB search
MNKKSVVIVAAKRTALGSFQGQFSSLSASDLGSYAISAAIEDSHIEPTQVDSVHMGCVLP
AGQGQAPARQASLKAGLPLSVPCNTVNKMCGSGMQAVMYGYNQILAGDANCVVAGGMESM
TNAPYLSTKLRGGLKMGHSEMIDHMFHDGLQDVKHGKLMGSFAELCAEKYGFTREQQDDF
AITSLQRANAATQSTAFESEITPVVVKNRKAETRYATDEQSAKADLNKIKTLRPAFKKDG
TVTAANASSISDGAAALVLMDVDEARKQGLQALATITAQAVHAQDPDWFSTAPIVAIQKV
LEKSGWAINDVDLFEINEAFAVVTMAAIETLNLDPEKVNVNGGACALGHPIGASGARVLV
TLIHALKARQLTKGVATLCIGGGEATAMAIEII
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaagcgttgttattgttgccgccaaacgaacggctttaggtagttttcaa
ggtcaattttcctcgcttagcgcatcagaccttggcagttacgccataagcgccgctatc
gaagacagccatattgaacccactcaagtagacagcgtgcatatgggctgcgtattacct
gccggacaaggccaagcacccgcacggcaagcctcattaaaagcaggtctaccgctatcg
gtcccttgtaatactgttaacaaaatgtgtggatctggcatgcaagcggtgatgtacggc
tataaccaaatattagcgggcgatgctaactgcgtggtcgcaggtggcatggaatcgatg
actaatgctccctacctttcaaccaaactacgtgggggccttaaaatgggccacagcgaa
atgattgatcatatgtttcacgatggcctgcaagatgttaaacatggcaaattaatgggt
tcatttgctgaactgtgcgcagaaaaatacggcttcacgcgtgaacaacaagatgatttt
gccattacctcattgcagcgagctaatgcagcgactcaatcaacggcttttgagtctgaa
ataacaccggttgtcgttaaaaatcgcaaagctgaaacgcgctatgcaactgatgaacaa
tcggccaaggccgaccttaacaaaatcaaaacactacgtcctgcttttaaaaaagatgga
acggttaccgccgccaatgcctcgtctatttctgatggtgcggctgccttggtattaatg
gatgtagatgaagcgcgcaaacaaggcctgcaagcgcttgcaaccatcaccgcgcaagca
gtacatgcacaagatcctgattggttcagcaccgcgcctattgttgctattcaaaaagta
ttagaaaaatcgggctgggctattaacgatgttgatttatttgaaataaatgaagccttt
gctgtagtcaccatggcagccattgaaacgcttaatttagaccctgaaaaagtgaatgtt
aatggtggtgcatgcgccttaggtcacccgattggtgcatcaggcgcgcgcgttctagtc
acattaattcacgcattaaaagctaggcaactgactaaaggggtcgccacgttatgtatt
ggcggcggtgaagccactgcaatggcaattgaaataatttaa

DBGET integrated database retrieval system