KEGG   Cycloclasticus sp. P1: Q91_1420Help
Entry
Q91_1420          CDS       T02265                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (Succinyl-transferring) complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00020  Citrate cycle (TCA cycle)
cyq00310  Lysine degradation
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01120  Microbial metabolism in diverse environments
cyq01130  Biosynthesis of antibiotics
cyq01200  Carbon metabolism
Module
cyq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cyq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Q91_1420
  Amino acid metabolism
   00310 Lysine degradation
    Q91_1420
Enzymes [BR:cyq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Q91_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AFT67457
UniProt: K0C6X8
Position
1492990..1494246
Genome map
AA seq 418 aa AA seqDB search
MSIEVVVPSLPESVADATLVTWHKQAGDTVLKDENLVDLETDKVVLEVPALSDGVLAEII
EPEGSTVLSGQLLARIEAGSAKPETPSPKATPAKSEPATTTLPAEKNSGSTEALSPAVRK
LVAEHGLDPQQIAASGKGGRITKTDVLNHIKQQSSNGVTTASATMSNSAPSKAAKATPMP
TLPTSERAEQRVPMTRLRAKIAERLIQAQQNTAMLTTFNEVNMQPIMDIRSKYKDQFSKV
HDTKLGFMSFFVKAAVESLKLFPSVNASVDEQDIIYHGYYDIGIAVSSPRGLVVPVLRDA
DLKNFAAIESGIAEFGIKARDGKLGIDDLTGGTFTITNGGVFGSMMSTPILNPPQSAILG
MHAINQRVMVENGEMVIRPMMYLALSYDHRIIDGKEAVSFLVTIKDFLEDPARLLLNV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgaagtcgtagtacctagccttccagaatccgttgccgatgccactttagta
acttggcataaacaagccggtgacaccgttttaaaagatgaaaatctagttgacctcgaa
acagataaagtagttttagaagtccctgcactgtcagatggtgtgttagcagaaatcatt
gagccagaaggttctactgtattaagtggccaattgctggctcgcatagaagctggtagc
gccaaaccagaaaccccaagcccaaaagcaacaccggcaaaatcagaaccagcaacaaca
actttacctgctgaaaaaaattcaggttcaactgaagcacttagtcctgctgttagaaaa
ctcgttgctgagcatggattagacccccaacaaattgcagcctcaggtaaaggcggcaga
atcaccaaaaccgatgtgctaaaccatatcaagcaacagtctagtaatggcgtcacaaca
gcttcagcaaccatgagcaattcggcaccgagcaaagcggctaaggcaacaccaatgcca
actttaccaacaagtgagcgtgcagaacaacgtgtgccgatgacacgccttcgagcaaaa
attgcagagcgcttaattcaagcacagcaaaacacggccatgttaacaacgtttaacgaa
gtaaacatgcagcctattatggacattcgcagtaaatataaagatcaattctcgaaagtt
catgatacaaaattaggctttatgtcattttttgttaaagcagccgttgagtcacttaag
cttttcccatcagtcaacgcctctgttgatgaacaagatattatttaccatggttattat
gatatcggcattgccgtttcatcacctcgcggcttagtagtgccggtactgagagatgca
gacctgaaaaattttgccgccattgaaagcggtattgctgaatttggtatcaaagcccgt
gatggaaaattaggcatcgatgatctaaccggcggtacatttacaatcactaatggtggt
gtatttggatcaatgatgtcgactcctattttgaacccaccacaaagtgctattttgggc
atgcatgccattaaccaacgagtgatggtagaaaacggtgaaatggttatacgtcctatg
atgtatctagccttatcttatgatcatcgaattatcgatggtaaagaagcagtgtccttt
ttagtcactataaaagacttcttagaagaccccgcaagattactgttaaacgtttaa

DBGET integrated database retrieval system