KEGG   Cycloclasticus sp. P1: Q91_1876Help
Entry
Q91_1876          CDS       T02265                                 

Gene name
apaG
Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
cyq  Cycloclasticus sp. P1
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Q91_1876 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4 CARDB DUF4354
Motif
Other DBs
NCBI-ProteinID: AFT67910
UniProt: K0C627
Position
1962412..1962795
Genome map
AA seq 127 aa AA seqDB search
MSDIKRQKIQVDVDTTYIASSSEPEAARYVFAYSITIKNTGNIEAQLLSRHWIITDANGK
VQEVHGEGVVGEKPHLQPGESFQYTSGAVIETSVGAMQGSYHLQDADGEKFTATIAPFSL
STPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatataaaacgtcaaaagattcaagtcgatgtagacactacttacatcgcctct
tcatctgaaccagaagcagcacgttacgtctttgcgtattctataacaattaaaaatacc
ggtaatattgaggcacaactcttgagccgtcattggattatcactgatgctaatggcaaa
gttcaagaagtgcatggcgaaggcgtcgttggcgaaaagcctcacctacaaccaggcgag
tcttttcaatatactagcggtgcggttattgaaacatcggtaggtgcgatgcaaggcagt
tatcatctacaagatgctgatggcgaaaagttcaccgctaccattgcgcccttttcttta
tccacgccaagaaccttgcactaa

DBGET integrated database retrieval system