KEGG   Cyanothece sp. ATCC 51142: cce_0199Help
Entry
cce_0199          CDS       T00686                                 

Gene name
chlI
Definition
(GenBank) magnesium chelatase, ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00860  Porphyrin and chlorophyll metabolism
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cce_0199 (chlI)
Enzymes [BR:cyt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     cce_0199 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 AAA ABC_tran AAA_18 DUF815 AAA_7 tRNA_lig_kinase RNA_helicase AAA_30 AAA_28 AAA_27 MMR_HSR1 FtsK_SpoIIIE AAA_33
Motif
Other DBs
NCBI-ProteinID: ACB49550
CyanoBase: cce_0199
CYORF: cce_0199
UniProt: B1X049
Position
184508..185584
Genome map
AA seq 358 aa AA seqDB search
MTATLQAPPKTHRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIEVVDNDPFNSHPSDPDLMSDNVRQALEEQGSLPVAHKKVIMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPNLRVQIVEQRSEFDRDP
QKFCETYQSQQEELQNSLVKAQNLLPSVNIDYDLRVKISEVCSELDVDGLRGDIVTNRAS
KALAAFEGRTEVTVDDIRRTMVLCLRHRLRKDPLETIDSGYKVEKAFNRVFGLETEEN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaccttacaagcacctccaaaaacccatcgcgttgtatttccctttacagct
attgtgggccaagaagaaatgaaattggccttactcctcaatgtcattgacccgaaaatt
ggcggtgtgatgattatgggcgatcgtgggacaggaaaatcgacgacgatccgagcttta
gccgacttactgcctgaaattgaagtggtagacaacgatccctttaactctcatccctct
gatccggatttgatgagtgacaatgtccgtcaagccttagaggaacaaggatcgttaccc
gttgctcacaaaaaagtgatcatggttgacttaccccttggtgcaaccgaggatagggtg
tgtggcaccattgatattgaaaaagctttatccgaaggggttaaagcatttgaaccaggt
ctattagctaaggcaaaccgagggatcttatatgtagatgaagttaacctccttgacgat
cacttagtagacgtattattagactctgcggccagtggttggaatacggtagaaagggaa
gggatttccattcgtcacccggctagatttgtgttagtggggtcaggaaaccccgaagaa
ggagagttgcggccgcaattattggatcgttttggaatgcacgcagagatccatacggtt
aaagaacccaacttacgagtacaaattgtagaacaacgatcagaatttgatcgtgatcct
caaaaattctgtgaaacttatcaatctcagcaagaagagttacaaaacagtttagtaaaa
gcgcaaaatctattgccttcggttaacatcgattatgatttacgggtaaaaatctccgaa
gtttgttcagaattggatgtggatggactacggggggatattgtaaccaaccgtgcatca
aaggcgttagcagcgtttgaaggccgtacagaggtgacggtagatgatattcgacggaca
atggtgttatgtttgcgtcaccgactcagaaaagatcccttagaaaccattgactcaggt
tacaaagtagaaaaagcttttaatcgtgtttttggactagaaactgaggaaaattag

DBGET integrated database retrieval system