KEGG   Cyanothece sp. ATCC 51142: cce_0490Help
Entry
cce_0490          CDS       T00686                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00270  Cysteine and methionine metabolism
cyt00480  Glutathione metabolism
cyt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    cce_0490 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    cce_0490 (gshB)
Enzymes [BR:cyt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     cce_0490 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ACB49841
CyanoBase: cce_0490
CYORF: cce_0490
UniProt: B1WP59
Position
complement(489688..490656)
Genome map
AA seq 322 aa AA seqDB search
MKFAFIIDPIANLNPVHDSTVAIMEAAQNLGHEVWITEVHQLSVIDGKAWAVLSQVQLTS
VTLQNGKWVSVSQWYQVSPGELRSLEDMDAVWMRKDPPVTIRYLYATYILELIDPTKTVV
INSPQGLREANEKMYTLQFYSVMPETVVSLDKKVIRQFVEEKQQAVLKPLGGKAGEGILF
LEPGDRNFNSIIEVSTYHGQEPVMVQRFLPEAKNGDKRIILLDGKPIGAVNRVPTGQEFR
GNMAVGGRVEKTQLTPREEHICEVVGPRLRKNGLYFVGIDVIGGYLTEVNVTSPTGIREI
DLLDGTNLGIEVVEWLTQVCSK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgcttttattattgatcccattgctaaccttaatcctgttcatgatagcact
gtggctattatggaagcagcccaaaatttaggccatgaagtctggatcaccgaagttcat
caattaagtgttattgatgggaaagcttgggccgttttatctcaagtgcagttaacgtct
gtgaccttacaaaacggaaaatgggtgagtgtgtcccagtggtatcaagtgtctccagga
gaattacgctctcttgaggacatggacgcagtgtggatgcgaaaagatcccccagtgacc
attcgttatctgtatgcgacttatatcctcgaattaattgatccgaccaagaccgtggtg
attaattcccctcaagggttgcgagaagccaacgagaaaatgtacaccctacaattttac
tcggtgatgcctgaaaccgtggttagtttggataagaaggttattcggcagtttgtagag
gagaaacaacaggccgtgttgaaaccgttagggggtaaagcaggggaaggaattttattt
ttagaacccggcgatcgcaattttaattcgattattgaagtgagtacctatcacggtcaa
gaaccggtcatggttcagcgatttttacccgaagccaaaaacggcgataaacgcattatc
cttttagatggtaaacccattggggcggtgaatcgagtccccacgggtcaagagtttcgg
ggtaatatggcagtgggtggacgggttgaaaaaacgcaattgacccctagggaagagcat
atttgtgaggttgtggggccaagattgcggaaaaatggcttatattttgttggtattgat
gtgattggcggttatttaacggaggttaatgttaccagtcccaccggtattcgagaaatt
gatctcctcgatggtacgaatttaggtatagaagtggttgagtggttaactcaggtttgt
tctaaataa

DBGET integrated database retrieval system