KEGG   Cyanothece sp. ATCC 51142: cce_0595Help
Entry
cce_0595          CDS       T00686                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00010  Glycolysis / Gluconeogenesis
cyt00052  Galactose metabolism
cyt00500  Starch and sucrose metabolism
cyt00520  Amino sugar and nucleotide sugar metabolism
cyt00521  Streptomycin biosynthesis
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
cyt01120  Microbial metabolism in diverse environments
cyt01130  Biosynthesis of antibiotics
cyt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_0595 (glk)
   00052 Galactose metabolism
    cce_0595 (glk)
   00500 Starch and sucrose metabolism
    cce_0595 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    cce_0595 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    cce_0595 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    cce_0595 (glk)
Enzymes [BR:cyt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     cce_0595 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ACB49946
CyanoBase: cce_0595
CYORF: cce_0595
UniProt: A1KYH1
Position
complement(593444..594487)
Genome map
AA seq 347 aa AA seqDB search
MTVLLAGDIGGTKTILRLVNSEQPKNGENLPQQTTLYEKSYPSQNYDDLVPIVQEFLKEA
KQELEQEITIKNGCFGIAGPVVNNTSELTNLSWSLTGDRLEKQLSLERVNLINDFAAIGY
GILGLEKDDLYILQDMEPKPNTPMAVLGAGTGLGECFLTPLESGIYEVFSSEGSHGDFAP
RNELEFELLTYIQDNYNLPRVSIERIVSGMGISAIYQFLRHKYPEKESEKFKEIYQAWES
KQKVDLSAEVSKAAMENNDALCQQTMELFISAYGAEAGNLALKILPYGGLYVAGGIAAKI
LPLLKKGSFIEAFKAKGRMSSLLAQMPVYVILNPKVGLIGAALRAAR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgactgtattactcgctggcgatattggaggaactaaaacaattttacgtttagttaat
tcggaacagcctaaaaatggagaaaatttacctcaacaaactaccttgtatgaaaaatct
tatcccagtcaaaactatgatgatttagttcctattgttcaagaatttttaaaagaagct
aaacaagaattagaacaagaaattaccatcaaaaatggctgttttggtattgctggacca
gtggttaataatacctcagaattaaccaatttaagttggtcattaactggcgatcgctta
gaaaaacagttatctttagaaagagtgaatctgattaatgattttgctgctattggttac
ggtattttggggttagaaaaagatgatttatacatcttacaagatatggaacccaaacct
aatacgccgatggcagttttaggtgccggaacggggttaggagaatgttttttgacccct
ttagaaagtggtatttatgaggtattttcttcagaaggatctcatggagactttgcgcca
cgaaatgaactagaatttgaattattaacttatattcaagataactataatttacctaga
gtgtccatagaaaggattgtttctggtatgggaattagtgcgatatatcaattcttacgt
cataaatatcctgaaaaagaatcagaaaaattcaaagaaatttatcaagcttgggaaagt
aaacaaaaggtggatttaagtgcagaagtgtctaaagcagcgatggaaaataatgatgct
ttatgtcaacaaacaatggaactatttatttcagcttacggcgcagaagctggaaattta
gctttaaaaatattaccctacggaggtttatatgtagcaggaggaattgctgctaaaata
ttacctttattgaaaaaaggatctttcatagaagcttttaaggctaaaggacgtatgagt
tcactgttagctcaaatgcctgtttatgttattttaaatcctaaagttggtttaattggg
gctgcgttaagggctgctagataa

DBGET integrated database retrieval system