KEGG   Cyanothece sp. ATCC 51142: cce_1117Help
Entry
cce_1117          CDS       T00686                                 

Definition
(GenBank) probable proteinase inhibitor I4, serpin
Organism
cyt  Cyanothece sp. ATCC 51142
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-ProteinID: ACB50467
CyanoBase: cce_1117
CYORF: cce_1117
UniProt: B1WU01
Position
1112054..1113340
Genome map
AA seq 428 aa AA seqDB search
MVMRTLKMTKATVGFLSICCLGGLIAISKTYLSNVFTDVRGLQEVSPRMIFPQPTLQERQ
LVDAQVQFGFKLFSTLTKSQKNENIFICPTSLALTLSMLYNGATGITQTEIARGLGFNDI
SANTLNRANQTLKQDLNSHDFYRYLTMTNSLWAREGFSFRYQFLKDSRSYYQAKITNLDF
ASSEARGIMNRWVTEETQGQIQEIMDHTQADDVLFLINTASFQGVWETGFDRNSMEDKPF
HLIDQSVKTYPFISRYGTYNYLETSQIKGVEIPYENGRFSLYLFLSKPENNLTQIVQELT
AKKLSKLLSKFQETNLLLELPRFTLNYEVDLTESLKKLGFSTMFDSGKAQFSELSSHPTY
VNGIKHQTTLVINEQGVKQTPQKNLVVKATSVNNVTEQMSFTADRPFFSLIRDNETGNIL
FMGMIFEP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgaggactctaaaaatgacgaaagccacagtaggctttctctctatctgttgt
ttgggtggtttaattgctatctcaaaaacatatctttctaatgtttttacagacgttcga
gggttgcaagaagtttccccaagaatgatttttcctcaaccaacccttcaagaaagacag
ttggttgatgcacaagtgcaatttggctttaaattattctctactttaacgaaaagccaa
aaaaatgaaaatatctttatttgtcccaccagtctcgccctgacgttatctatgctctac
aatggagcaacaggaatcacgcaaacagaaatcgctagggggttaggcttcaatgatatt
agtgccaatacccttaaccgcgctaatcaaaccctaaagcaagacttaaatagtcatgac
ttttatcgttacttaaccatgactaattctctgtgggctagggaaggattttcgtttcgt
taccaatttcttaaggatagtcgtagttattatcaagcgaaaatcactaacttggacttt
gcaagttctgaagctaggggcattatgaaccgttgggtaacagaagaaactcaaggtcaa
atccaagaaattatggatcacactcaggctgatgatgttctgtttctaatcaatacggct
tcttttcaaggagtctgggaaacgggatttgatagaaattctatggaggataaaccgttt
catttaatcgatcaatccgttaaaacttatccttttatatctcgttacggaacctataac
tatctcgaaacttctcaaatcaaaggggtagaaattccttatgaaaacggacgttttagt
ttatatttatttttatccaaacccgaaaataatttaactcaaatcgtacaagagttaacc
gctaaaaagttatcaaaactcttatctaaatttcaagaaactaacctgttattagagttg
cctcggtttactttaaattatgaggtagatttgacagaatcattgaaaaaattaggattt
tcaactatgtttgattctggtaaagcgcagttttctgaattaagttctcatcctacctat
gtcaatgggattaaacatcaaacaactctagtcattaacgaacaaggggttaaacagacc
cctcaaaagaacttagtggttaaagcaacttcagtcaataatgtaacagaacaaatgtct
tttacggctgatcgtccttttttctctctaattagggataatgaaacagggaatatttta
tttatgggaatgatttttgaaccttaa

DBGET integrated database retrieval system