KEGG   Crocosphaera subtropica: cce_1608Help
Entry
cce_1608          CDS       T00686                                 

Gene name
bvdR
Definition
(GenBank) oxidoreductase, putative biliverdin reductase
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
cyt  Crocosphaera subtropica
Pathway
cyt00860  Porphyrin and chlorophyll metabolism
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cce_1608 (bvdR)
Enzymes [BR:cyt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     cce_1608 (bvdR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACB50958
CyanoBase: cce_1608
CYORF: cce_1608
UniProt: B1WXX1
Position
1617073..1618104
Genome map
AA seq 343 aa AA seqDB search
MDIYRGQVRMSLPSQLSHPIKVGIVGTGYAAKRRAETFMEDERSQLCCVTGYTRENVVDF
CQSYNISSYENWEDLVTDKRLDLIVICNVNKLHGIITKLALEHNKNVIIEYPLSLDYTEA
VELLELARKKDKLLHIEHIEILGGMHRAVQKYLPQIGKVFYGRYTTIDSKNPAPIRWTFN
HQLFGFPFKAALPRIHRFTHLFGEVKSVNCHQKYWNREEEDYYHGCLCDAQLLFQNGLIV
DLIYGKGDMFIESDRTFEIHGEKGKIIFEGMEGKLITQDGTQPIELESRRGLFALDTKIV
LDRLFDNKPLYLDPESSLYALKIGEAAYQSARLGKIVEIENSA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttggatatttatagaggtcaggtaaggatgtctcttccttctcagctttctcatcctatt
aaagtgggtattgttggcactggatatgcagcgaaacgacgggccgaaacgtttatggaa
gatgagcggtcgcagctttgttgtgtgacaggatatactcgtgaaaatgtagttgatttt
tgtcagtcttataatatttcctcttatgaaaattgggaagatttagtaacggataaaagg
ttagatttaatcgtaatttgtaatgttaataaacttcatggaatcattactaaactggcg
ttagaacataataaaaatgtcatcatcgaatatcctttatcgttagactatactgaagca
gtcgaattattagaattagcaagaaaaaaagataaattattacatattgaacatatcgaa
attttagggggaatgcaccgagccgtacaaaaatatttaccccaaatcggtaaagttttt
tatggacgttatactaccattgatagtaaaaatcctgccccgattagatggacatttaat
catcaattatttgggtttccatttaaagcagcgttaccgagaattcaccgttttactcat
ttatttggtgaagttaagagtgtaaattgtcatcaaaagtattggaatagggaagaagaa
gactattatcatggctgtttatgcgatgctcaattattgtttcaaaatggcttaattgtt
gacttaatctatggcaaaggagatatgtttattgaaagcgatcgcacctttgaaatccac
ggagaaaagggaaagattatttttgaaggcatggaaggaaagttaattactcaagacggg
acacaacccattgagttagaaagtcgtcggggtttatttgctttagataccaagatagtt
ttagatcgtttatttgataataaacccctttatcttgacccagaatccagtttatatgcc
ctaaaaattggagaagctgcttatcagtccgctaggttaggcaaaatagtagaaattgag
aattcagcatga

DBGET integrated database retrieval system