KEGG   Cyanothece sp. ATCC 51142: cce_2560Help
Entry
cce_2560          CDS       T00686                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase
  KO
K18916  phosphonate dehydrogenase [EC:1.20.1.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Brite
KEGG Orthology (KO) [BR:cyt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    cce_2560
Enzymes [BR:cyt01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.1  With NAD+ or NADP+ as acceptor
    1.20.1.1  phosphonate dehydrogenase
     cce_2560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored IlvN Rossmann-like
Motif
Other DBs
NCBI-ProteinID: ACB51908
CyanoBase: cce_2560
CYORF: cce_2560
UniProt: B1WSC2
Position
2624718..2625716
Genome map
AA seq 332 aa AA seqDB search
MNQKPKVVITHWVHPEIIDYLTPHCELILNQTKETLTREEVINRSKDAQGLMVFMPDYID
VNFLEACPQLKVISGALRGYDNFDVEACTKRNIWFTIVPDLLAAPTAELTIGLLLILARR
MVEGDRLIRSGNFQGWKPQLYSTGLLNKTLGIIGMGKLGKALTKRLMGFDMTLLYHDKIT
LTSQQERDWKITKTSLEELLTKSDYVVLMVPLVPDTYHLINENSLKMMKPNSFLINPCRG
SIVDETAVATAIKSGHLAGYAADVFEMEDWAIANRPQSINQTLLTDINHTFFTPHLGSAV
NEVRRDIALEAAKNIIEVLSENRPQGAVNGIV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaacctaaagttgtgattacccattgggttcatccagaaatcattgactat
ttaactccacattgtgagcttattcttaatcaaacaaaagaaaccttaacccgtgaagaa
gttattaatagaagcaaagatgctcaaggtttaatggtttttatgccagattatattgat
gtaaattttttagaagcctgtcctcaattaaaagtaatttcaggagccttaagaggctat
gataattttgatgtagaagcttgcacaaagcgaaatatttggtttactattgttcctgat
ttattagctgcacctacagcagaattaaccataggattactactaatattagcccgtaga
atggtagaaggcgatcgcctaattcgttcgggtaattttcagggttggaaacctcaatta
tacagtacaggattattaaataagaccctcggaattattggtatgggcaagttaggaaaa
gccttgacaaaacggttaatgggctttgatatgaccctgttatatcatgataaaattact
ctaacaagccaacaagaaagagattggaaaattaccaaaacctctctagaagaattatta
acaaaaagtgattatgttgtgttaatggttcccttagttcctgatacctatcatttaatt
aatgagaatagtttaaaaatgatgaaacctaatagttttttaattaatccttgtcggggt
tccatagtagatgaaaccgccgtagctactgccattaaatcaggacatttagccgggtat
gctgctgatgtttttgaaatggaagattgggcgatcgccaaccgtcctcaaagcattaat
caaaccttattaactgatataaaccatactttttttacaccccatttaggctcagccgtt
aatgaggttcgtcgtgatattgccctagaagcagccaaaaatattatcgaagttctctca
gaaaacagaccacaaggtgctgtaaatggtatcgtatag

DBGET integrated database retrieval system