KEGG   Cyanothece sp. ATCC 51142: cce_3134Help
Entry
cce_3134          CDS       T00686                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00260  Glycine, serine and threonine metabolism
cyt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyt01100  Metabolic pathways
cyt01110  Biosynthesis of secondary metabolites
cyt01130  Biosynthesis of antibiotics
cyt01230  Biosynthesis of amino acids
Module
cyt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cce_3134 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cce_3134 (trpB)
Enzymes [BR:cyt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cce_3134 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACB52482
CyanoBase: cce_3134
CYORF: cce_3134
UniProt: B1WX13
Position
3245960..3247198
Genome map
AA seq 412 aa AA seqDB search
MTTTPISPSSNQTQYPDEIGRFGQYGGKYVPETLMPALSELETAYRRYKDDPDFQAELSQ
LLKDYVGRPSPLYFAERLTEHYARPDGTGPQIYLKREDLNHTGAHKINNALGQVLLAKRM
GKQRIIAETGAGQHGVATATVCARFGLECVIYMGIHDMERQKLNVFRMKLLGATVQPVEA
GTGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVRDFHHIIGQETRQQCQEKWD
TLPDILLACVGGGSNAMGLFYEFVKDADIRIIGVEAAGESIVSGKHAATLTKGRPGVLHG
AMSYLLQDEEGQVIEAHSISAGLDYPGVGPEHSYLKDSGRAEYYSVTDAEAVAAFQRLSE
LEGIIPALETSHAIAYLETLCPQLEGSPRIIINCSGRGDKDVQTVAKYLGNE
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccacacccatttccccatcatcaaatcaaacccaataccctgatgagatcgga
cgctttggccagtatgggggaaaatatgtgcctgaaaccttaatgccggctttgagcgaa
ctggaaaccgcttatcgtcgctacaaagatgatcctgactttcaagcagaattatcacaa
ttattaaaagattatgtcggtcgtcccagtcccctctattttgctgaacggttaaccgaa
cattacgcccgtcccgatggtactggtccacaaatttatctaaaacgggaagatttaaac
cacactggcgcgcataaaattaataacgccctcggtcaagttttattagcgaaacgcatg
ggtaaacagcgtattatcgcagaaaccggagccggacagcatggggtggcaacggccacg
gtttgcgcccgttttggcttagaatgcgtcatttacatgggcattcatgatatggaacgg
caaaaacttaatgtcttccgcatgaaactgttaggggcaacagtgcaacccgtagaagca
ggaaccggaacccttaaagatgcgacttcagaagccattagagactgggtaactaacgta
gaaaccactcattatattttaggttcggtagctggtccccatccttatccaatgattgta
cgagactttcatcatattattggccaagaaacccgtcagcaatgtcaagaaaaatgggac
actttacccgatattttactggcttgtgtaggtggtggttctaatgccatgggactgttt
tatgagtttgtcaaagatgctgacattcgtattattggagtagaagcagctggggaaagt
attgtttctggaaaacacgcggcaaccctgacaaaaggtcgtccaggggtcttacacggg
gcaatgagttatttattacaagacgaagaaggacaggtgatagaagcccattctattagt
gcagggttagattatcctggggttggacctgaacatagttatcttaaagatagtggtcgt
gctgaatattatagtgttacggatgctgaagctgtggcggcctttcaacggttatctgag
ttagaagggattattccagctttagaaacgtctcatgcgatcgcctatttagaaaccctt
tgtcctcaacttgaaggcagtccccgtattattattaattgttcaggccgaggagacaaa
gatgtgcaaacagtggctaaatatttagggaatgagtag

DBGET integrated database retrieval system