KEGG   Cyanothece sp. ATCC 51142: cce_4591Help
Entry
cce_4591          CDS       T00686                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00230  Purine metabolism
cyt01100  Metabolic pathways
Module
cyt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    cce_4591 (gmk)
Enzymes [BR:cyt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     cce_4591 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 MMR_HSR1 RsgA_GTPase AAA_22 AAA_18 AAA_28 ABC_tran AAA AAA_29 AAA_14 TsaE DUF4624 NTPase_1 cobW RNA_helicase CPT AAA_30 DUF815
Motif
Other DBs
NCBI-ProteinID: ACB53939
CyanoBase: cce_4591
CYORF: cce_4591
UniProt: B1WVE9
Position
4738811..4739380
Genome map
AA seq 189 aa AA seqDB search
MASGKLIVLTGPSGVGKGTLVRALLNHHPELYLSISATTRSPRQGEVEGKDYYFLSKSAF
ETMIEENQLLEWAEYAGNYYGTPRTKVEEKINQGLIVLLEIEVIGAKAIKNSFPDALRIF
ILPPSIEELEHRLRSRKTDSESAILRRLDRAKEELAVSEEFDKCIINDDLEIALAQLEKA
IFFDSSITN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaggaaagctcattgtattaaccggtcctagcggtgtgggaaaaggcacctta
gtccgtgctttattaaaccatcatcccgaactctatttatctatttctgccaccactcgt
tctcctcgtcagggggaagtagagggtaaagattactattttttaagtaagagtgccttt
gaaaccatgattgaggagaatcagttattagaatgggcagaatatgccggtaattattat
gggactccccgtactaaggttgaagaaaaaattaaccaaggtttaattgtgcttctagaa
atagaagtgattggggcaaaagccataaaaaacagctttcctgatgctttgagaattttt
atccttcccccttcaattgaagaattagaacatcgtttaagaagtcgaaaaacggactca
gaatcagcaattttacgtcgtttagatagggcaaaagaagaattggcagtcagtgaagaa
ttcgataagtgtattattaatgatgatttagaaatagctttagcgcaactagaaaaggct
attttttttgattcatcaataacgaactaa

DBGET integrated database retrieval system