KEGG   Cycloclasticus sp. PY97N: CPC19_03495Help
Entry
CPC19_03495       CDS       T05126                                 

Definition
(GenBank) HAD family hydrolase
  KO
K20881  5'-nucleotidase [EC:3.1.3.5]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
cyy00230  Purine metabolism
cyy00240  Pyrimidine metabolism
cyy00760  Nicotinate and nicotinamide metabolism
cyy01100  Metabolic pathways
cyy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CPC19_03495
   00240 Pyrimidine metabolism
    CPC19_03495
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CPC19_03495
Enzymes [BR:cyy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     CPC19_03495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ATI02560
Position
708966..709619
Genome map
AA seq 217 aa AA seqDB search
MINWSEIETVLLDMDGTLLDLRFDNHFWQRVVPDYFANKEGISFDEAIKQLEPLFKAQEG
LLNWYCLDYWSEALGIDIVKLKVETQEHIKELPHTRDFLGAIKASGKRCVLVTNAHAESL
NLKMQKTGLVEFFDAIVSAHDFGYPKEQQSFWHAFHQLEQFDKSKTVMVDDSLSVLKAAD
TFGIQYIVAITKPDSAEPPRIVHDYLAVESLGAIQPK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgattaattggtcggaaatagaaactgttttattggatatggatggtactttgttggat
ctacggttcgacaaccatttttggcaacgtgttgtgcctgattattttgctaataaggaa
ggtatttcatttgatgaagcaattaaacagctagagcctctttttaaagcccaagaaggc
ttgttaaattggtattgcttagattattggagcgaggcattaggtattgatattgttaag
ctaaaagttgaaacacaggaacatattaaagaattgccgcatacacgcgattttttagga
gctataaaagcatcgggtaaacgctgtgtgttggtaacaaatgcacatgcagagagttta
aacctaaaaatgcaaaaaacaggtttggtagagttttttgatgcgattgtttctgcgcat
gattttggttaccccaaagagcagcaaagtttttggcatgcttttcatcagctggagcag
tttgataaatctaaaaccgtgatggtggatgatagtttaagtgtgttgaaggcagccgat
acatttggcattcaatacatcgtcgctattactaaacccgatagcgctgagccaccgcgt
atcgtacatgactatttagcagtcgaaagtcttggcgctattcagccaaaataa

DBGET integrated database retrieval system