KEGG   Cycloclasticus sp. PY97N: CPC19_06820
Entry
CPC19_06820       CDS       T05126                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
cyy00626  Naphthalene degradation
cyy01100  Metabolic pathways
cyy01120  Microbial metabolism in diverse environments
cyy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cyy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CPC19_06820
Enzymes [BR:cyy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     CPC19_06820
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ATI03195
Position
complement(1379282..1380280)
AA seq 332 aa
MARRQDRLTVEDVNGAWAIIPTPAIETGDQWQTEDSVDYDEIARAVDGLIESGVDAIMSQ
GTFGEGATLTWEEKKKMMEVMVETSAGRVPIFVGVTTMNTRETIRQLRHARDIGADGTML
GLPMWQQIDVPAAVRFYQDVAEAVPEMAIAIYANPEAFKFDFPAPFWAQVANIPQVITCK
YINIAQLHLHTMVSKKQIRFLPLEIDHADAAKMDPEFNTAFWSPLACTGPELTMHWRDSV
REAAKTGDWSRPDELYPQMALALSSLFPPGGFAEFSKYNIQLEKARINAAGWMKAGPCRP
PYMTAPEHYLEGAAKSGTGWAELNKKLLEGTL
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctagaagacaagacaggttaacagtagaagatgtgaatggtgcttgggcaatcatt
cctacaccagcgattgaaactggtgatcaatggcaaacagaagacagcgttgattatgac
gaaatcgctagagctgttgacggccttattgaatctggtgttgacgccatcatgagccaa
ggaacttttggagaaggcgctacccttacttgggaagaaaagaaaaaaatgatggaagtc
atggttgaaacttcagccggacgagtacctatctttgttggtgttacaacaatgaatact
cgcgagactattcgtcaattacgtcatgcacgagatattggtgctgacggaacaatgtta
ggcttaccaatgtggcagcaaattgatgtacctgcagctgttcgtttctatcaagatgtt
gctgaagctgtgcctgaaatggcaatcgctatttacgctaacccagaagcatttaaattt
gatttcccagctccattttgggctcaagttgctaacattccacaagtcatcacttgcaag
tacataaatattgctcaactacacttgcacacgatggtttcaaaaaagcaaattagattt
ttgccactagaaatcgatcacgcagatgctgctaaaatggatccagaattcaacactgct
ttttggtcaccacttgcttgtacaggccctgagctaaccatgcattggcgtgacagtgtt
agagaagccgctaaaacaggtgactggagtagaccagacgagctttacccacaaatggca
ttagcactgtctagcttattccctcctggaggctttgctgaattttctaaatataacatt
cagttagaaaaagcgcgtattaatgcagctggttggatgaaagcaggtccatgccgccct
ccttacatgacagcacctgaacactacttagaaggcgctgctaaatctggtacaggttgg
gctgagttaaataaaaaattacttgaaggcacactttaa

DBGET integrated database retrieval system