KEGG   Cycloclasticus sp. PY97N: CPC19_07720Help
Entry
CPC19_07720       CDS       T05126                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
cyy00903  Limonene and pinene degradation
cyy00930  Caprolactam degradation
cyy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cyy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CPC19_07720
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CPC19_07720
Enzymes [BR:cyy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     CPC19_07720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 COesterase Hydrolase_4 Peptidase_S9 DUF3089
Motif
Other DBs
NCBI-ProteinID: ATI03361
Position
1571137..1572033
Genome map
AA seq 298 aa AA seqDB search
MASIRSQLLAKVLRMTIKRKFTASRNLVQERDNMDKLAVMSVKPERGRVTTLGGVPGEWH
EAQLGSKETTILYLHGGGYVVGSPTSHRGLAAMLANLAQARVFVLDYRLAPEAPFPAALD
DAVSAYKALLDDGKDPKKIVIAGDSAGGGLTISLMLALKEQSIPLPATGICLSPWVDLSF
SGDSMQTNAKADAILCKESLTWLADQYLGDVAADDRRVSPLFAELNGLPPLLIQVGSDEV
LLDDAVRLNKFAKKAGVDTTLEVWHGQVHVWQLMSRLIPEAHQAIHSIGTFIKTHIDD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcatacgaagtcagttattagcgaaggttttgcgaatgaccattaaaaggaaa
ttcacagccagtcgtaatttggttcaagaacgcgataacatggacaagttagcagtcatg
agcgtcaaaccggaacgagggcgagtgactaccttagggggtgttcccggcgaatggcat
gaagcgcaattaggcagtaaagaaacgactattttatatttgcatggtggtggctacgtg
gttggatcgcctaccagccatagaggcttggcagccatgttagctaatttagctcaagca
agggtatttgttttagattaccgtttagcaccagaagcccccttcccagctgcactggac
gatgcagtgtctgcatataaagccttgttagatgacggcaaagatccgaaaaaaattgtt
attgcaggtgattcagccggtggagggcttactatttcactgatgcttgccttaaaagag
cagtccatcccattaccggctacaggtatctgcctgtctccttgggtcgacttaagcttt
tctggtgactcgatgcaaacgaatgccaaggcagatgcaattttatgtaaggaatcctta
acatggttagctgatcaataccttggtgatgtagccgcggatgaccgacgagtttcacct
ctttttgccgagctaaacggactccctcccctattaattcaagttggcagtgatgaggta
ttactggacgatgccgtccgtttgaacaaatttgcaaaaaaagcaggtgtcgatacaacg
cttgaagtttggcatggccaagttcatgtctggcagttaatgtccagattgattccagaa
gcgcaccaagccattcattcgatagggacttttatcaaaacccatatagatgattaa

DBGET integrated database retrieval system