KEGG   Cycloclasticus zancles: CYCME_1870Help
Entry
CYCME_1870        CDS       T02780                                 

Gene name
oadA
Definition
(GenBank) Oxaloacetate decarboxylase, alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
cza  Cycloclasticus zancles
Pathway
cza00620  Pyruvate metabolism
cza01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cza00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CYCME_1870 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cza02000]
    CYCME_1870 (oadA)
Enzymes [BR:cza01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     CYCME_1870 (oadA)
Transporters [BR:cza02000]
 Other transporters
  Primary active transporters [TC:3]
   CYCME_1870 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 Peptidase_M23 GCV_H
Motif
Other DBs
NCBI-ProteinID: AGS40185
UniProt: S5TYD8
Position
complement(1882713..1884506)
Genome map
AA seq 597 aa AA seqDB search
MKNPLKITDVVLRDAHQSLFATRLRIEDMLPIAEKLDKIGYWSLETWGGATFDACIRYLG
EDPWERLRLLKAAMPNTQQQMLLRGQNLLGYRHYADDVVRKFVERAADNGMDVFRIFDAM
NDVRNLETAIKATVEVGKHAQGTISYTESPVHTLENWVDMGKRLEDAGCHSIAIKDMAGL
LKPYDAEILVKRLKAECDLPIALHSHATTGMSVATCLKAVDAGLDMLDTAISSMSMTYGH
SPTETFIAMLEGTDRETGLDIESVEEVAAYFRSVRPKYAEFEGSLKGVDSRILIAQVPGG
MLTNLESQLKLQNAGDKIDEVLAEIPRVRKDLGYLPLVTPTSQIVGTQAVMNVLMGERYK
SISKETSGVLKGEYGATPAAVNKELQERVLDGAEAIACRPADLIDDELEKISSEFKEKAE
KDSLPLADEVIDDVLTYALFPQIGLDFIKNRHNPDAFEPVPTGVVTQATAEKGGSEVYDV
AVNGKTYQVEVGPSGSIENLTPSSAASKVVAKAAEPTQETTSGAVCQNEPLLSPMAGNIV
RIAMAAGDDVYEGDVVIILEAMKMETEVRAHIEGQISDVFVKEGESVPAGAPLVLIC
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcctttaaaaattactgatgtcgtgttgcgcgatgctcatcaatccctattt
gcaaccaggttacgtattgaagatatgttaccgattgcggaaaaattagacaaaattggc
tattggtcattagaaacttggggcggagcaacatttgatgcttgtattcgttatttaggt
gaagacccatgggagcgtttgcgattactaaaagcggcgatgcctaatacacaacaacaa
atgctattacgtgggcagaacctattaggctatcgtcattatgctgatgatgttgttaga
aagttcgtagagcgtgctgcagacaatggtatggatgttttccgtatttttgatgcgatg
aacgatgtgcgtaacttagagacggccattaaagcaactgtcgaagtaggcaaacatgcg
caaggtacaatctcatatacagaaagcccagtacacacgctagaaaattgggtcgatatg
ggtaagcggttagaagatgccggctgccattcgatcgcgattaaagatatggcaggactt
ttgaaaccttatgatgctgagatattggtgaagcgtttaaaagccgagtgtgatctacca
attgctttacacagccatgcaacaactgggatgagtgtagcaacctgtcttaaagcagtc
gatgcagggcttgatatgctagacacagctatttcgtccatgagtatgacatacggtcat
tcaccaacggaaacctttattgcaatgttggaaggaactgatcgcgagacgggtctagac
attgagagcgttgaagaagtagcggcctattttagatcagtacggccaaagtatgcggag
tttgaagggtcgctgaaaggtgtcgattcaagaattcttattgcacaggtccctggtggc
atgttgacaaacctagaaagtcaattgaagctgcaaaatgcaggtgacaaaattgatgag
gtgttagcagaaattccacgtgtacgtaaggaccttggctatcttcctttagtaacccca
acatcacaaattgtaggtactcaggcagtgatgaacgttttgatgggtgagcgttataaa
tctatcagcaaagaaacatcaggtgtattaaaaggcgaatatggtgcaacacctgcagca
gtgaataaagagcttcaagagcgtgtattggatggcgctgaagcgattgcttgtcgtcca
gctgacttgattgatgatgagttggagaaaatttcatcagaatttaaagaaaaagccgaa
aaagatagtttgccattggccgatgaggtcattgatgatgtgttgacatatgcgttattt
ccacagataggcttggactttattaaaaatagacataaccctgatgcgtttgagccggtt
ccaacaggcgttgttactcaagcaacagctgaaaaaggcggtagtgaagtatatgatgtg
gccgttaatggtaaaacatatcaggttgaagtgggtccaagtggctcgattgaaaatcta
acaccttcttcagctgctagtaaagtggttgcgaaagcagctgaaccaacacaagagaca
acatcaggcgcggtttgtcaaaatgaacccttgttgtctccaatggccggtaatattgtg
cgcatagcaatggcggcaggagatgatgtgtatgaaggtgatgtagtgattattttagaa
gccatgaagatggaaactgaagtaagggcgcatattgaaggtcaaatttcagatgttttc
gtaaaagaaggtgagtcagttcctgctggcgcgccgttagtacttatttgctaa

DBGET integrated database retrieval system