KEGG   Cycloclasticus zancles: CYCME_2102Help
Entry
CYCME_2102        CDS       T02780                                 

Definition
(GenBank) Acetaldehyde/propanal dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
cza  Cycloclasticus zancles
Pathway
cza00362  Benzoate degradation
cza00620  Pyruvate metabolism
cza00621  Dioxin degradation
cza00622  Xylene degradation
cza00650  Butanoate metabolism
cza01100  Metabolic pathways
cza01120  Microbial metabolism in diverse environments
cza01220  Degradation of aromatic compounds
Module
cza_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:cza00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CYCME_2102
   00650 Butanoate metabolism
    CYCME_2102
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CYCME_2102
   00622 Xylene degradation
    CYCME_2102
   00621 Dioxin degradation
    CYCME_2102
Enzymes [BR:cza01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CYCME_2102
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     CYCME_2102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DUF2859
Motif
Other DBs
NCBI-ProteinID: AGS40416
UniProt: S5T9L8
Position
complement(2132846..2133751)
Genome map
AA seq 301 aa AA seqDB search
MAINCAMIGSGNIGTDLMAKLQRSPNLNPLWMVGIDPDSEGLLKAREAGLKTTHEGVDGL
IPHIEEDNIQIAFDATSAYVHGENNRKLQEKGVLVIDLTPAAIGPFCVPPVNLKEHVGEQ
EMNVNMVTCGGQATIPMVAAVSQVQAVEYGEIVATVASKSAGPGTRKNIDEFTRTTARAV
EEIGGAKKGKAIIILNPAEPPLIMRDTVHCLTEEEPDQKAITESVHAMIKEVQKYVPGYK
LKNGPIFDGHRVSIFLEVEGLGDYLPKYAGNLDIMTAAGTRTAEMFAEEIENGTLTLTKL
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaattgcgcaatgattggttccggtaatatcggcaccgacctaatggctaag
ctacaacgtagtccaaatttaaacccgctgtggatggtaggtattgatcctgactcagag
ggcttattaaaagctcgagaagcaggcctaaaaaccacgcatgaaggtgtagatggctta
attccacatattgaagaagataatatacaaattgcatttgatgcaacgtctgcatatgtg
catggagaaaataaccgtaaattgcaagaaaaaggcgtgttagtgattgatttaacgccg
gcagctattggcccattttgtgttccacctgttaacttgaaagagcacgtgggtgagcaa
gaaatgaacgttaatatggtgacctgtggtggccaagcaacgataccgatggtggctgct
gtgagtcaagttcaggcagtagagtacggtgagattgttgcaacagttgcatcaaaatca
gcaggcccgggcacacggaaaaatattgatgaattcacaaggacgacagcccgagccgtt
gaagaaattggtggtgctaagaaaggcaaagcgattattattttaaaccctgcagagcca
cctttaattatgagggatactgttcattgcttaactgaagaagaaccagatcaaaaagca
attacagaatcagttcacgcaatgattaaagaagtgcaaaaatatgtgccaggctataag
ttaaaaaatggaccaatttttgatggacatagagttagtatatttctagaggttgaaggg
ctaggagattaccttccaaagtatgccggtaatttggatattatgacggctgctgggaca
agaacagcagaaatgtttgccgaagagattgaaaacggcacactgacattaaccaaatta
gcttag

DBGET integrated database retrieval system