KEGG   Cycloclasticus zancles: CYCME_2228Help
Entry
CYCME_2228        CDS       T02780                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cza  Cycloclasticus zancles
Pathway
cza00071  Fatty acid degradation
cza00072  Synthesis and degradation of ketone bodies
cza00280  Valine, leucine and isoleucine degradation
cza00310  Lysine degradation
cza00362  Benzoate degradation
cza00380  Tryptophan metabolism
cza00620  Pyruvate metabolism
cza00630  Glyoxylate and dicarboxylate metabolism
cza00640  Propanoate metabolism
cza00650  Butanoate metabolism
cza00900  Terpenoid backbone biosynthesis
cza01100  Metabolic pathways
cza01110  Biosynthesis of secondary metabolites
cza01120  Microbial metabolism in diverse environments
cza01130  Biosynthesis of antibiotics
cza01200  Carbon metabolism
cza01212  Fatty acid metabolism
cza02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cza00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CYCME_2228
   00630 Glyoxylate and dicarboxylate metabolism
    CYCME_2228
   00640 Propanoate metabolism
    CYCME_2228
   00650 Butanoate metabolism
    CYCME_2228
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CYCME_2228
   00072 Synthesis and degradation of ketone bodies
    CYCME_2228
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CYCME_2228
   00310 Lysine degradation
    CYCME_2228
   00380 Tryptophan metabolism
    CYCME_2228
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CYCME_2228
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CYCME_2228
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CYCME_2228
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cza04147]
    CYCME_2228
Enzymes [BR:cza01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CYCME_2228
Exosome [BR:cza04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CYCME_2228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGS40540
UniProt: S5TZ86
Position
complement(2267547..2268734)
Genome map
AA seq 395 aa AA seqDB search
MSEVREVVVLSAVRTAIGDFGGSLKTVEPSTLAAITLKESVARSGIEPAEVGMVVMGTVV
PEEERAPYTARIAQIEAGIPCETSCVAVNRLCGSGMQAIVDAAQGIMLGDYDVAIGAGVE
SMSNSLYALPGARWGQKMGAGQMIDLMISALTDPFGTGHMGMTAENLADKYNISREDQDA
LAVMSHQNAARAQAEGRFDSQIVPVEIKTRKGVTVFDKDEHVRPDISVEKLSGMRPAFKK
DGSITAGNASGINDASSAMVLMAKEAAEARGLKPMAKLVAYSHAGVEPEIMGIGPVPAVE
KILSATGLTIGDIDVFEVNEAFAAQALSVCRELDLPMDKVNVNGSGISLGHPIGASANII
VVKALHELERVQGKYALATLCIGGGQGIATLWERM
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtaagagaggttgtcgtactaagcgctgtcagaactgcgattggtgatttt
ggtggaagtttaaaaaccgtagagccgagcaccttagcggccattacgctcaaggaaagt
gttgccagatcaggtattgaacctgcagaggttggtatggtggtgatgggtacggttgtt
cctgaagaagagagggcgccttatactgctcgtattgcacaaattgaagcgggtattcct
tgtgaaacatcttgtgttgcggtcaacaggctctgtggcagtggtatgcaagctattgtg
gatgctgcgcaagggattatgctaggtgattatgacgttgccattggtgccggtgttgaa
tcaatgagtaactccttgtacgccttacctggcgctcgttgggggcaaaaaatgggtgct
ggtcaaatgattgatttaatgatctccgcattaactgatccatttggaacaggtcatatg
gggatgacggctgaaaacttagcagataaatacaatatttctcgagaagaccaagacgca
ttagccgtaatgagtcatcaaaatgcagcgcgtgcacaagcagaaggtcgttttgatagt
caaattgttccagtagaaattaaaacgcgtaagggtgtgacggtctttgataaagacgag
catgttcgtcctgatatcagcgttgagaagttatctggtatgcgcccagcctttaagaaa
gacggtagcatcacagcgggtaatgcatcgggcattaacgatgcgtcgtctgcaatggta
ttgatggctaaagaggcagcagaagcgcgtggtttaaaaccgatggcaaaattagtggct
tactcccatgctggtgttgaaccagaaattatggggattggtcctgtacctgctgttgag
aaaattttatcggcaacaggtttgacgattggcgatattgatgtgtttgaggtgaatgaa
gcgtttgctgcccaggcgttaagcgtttgtcgagaacttgaccttccaatggataaggtg
aatgttaacggaagtgggatttcattaggtcacccaattggggcatctgcaaatattatt
gttgtaaaagcactgcatgaattagagcgtgttcaaggcaaatacgcattggctactttg
tgtattggtggtgggcaaggtattgcgactctttgggaacgcatgtag

DBGET integrated database retrieval system