KEGG   Defluviimonas alba: AKL17_0161Help
Entry
AKL17_0161        CDS       T04387                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
daa  Defluviimonas alba
Pathway
daa00071  Fatty acid degradation
daa00072  Synthesis and degradation of ketone bodies
daa00280  Valine, leucine and isoleucine degradation
daa00310  Lysine degradation
daa00362  Benzoate degradation
daa00380  Tryptophan metabolism
daa00620  Pyruvate metabolism
daa00630  Glyoxylate and dicarboxylate metabolism
daa00640  Propanoate metabolism
daa00650  Butanoate metabolism
daa00900  Terpenoid backbone biosynthesis
daa01100  Metabolic pathways
daa01110  Biosynthesis of secondary metabolites
daa01120  Microbial metabolism in diverse environments
daa01130  Biosynthesis of antibiotics
daa01200  Carbon metabolism
daa01212  Fatty acid metabolism
daa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:daa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AKL17_0161
   00630 Glyoxylate and dicarboxylate metabolism
    AKL17_0161
   00640 Propanoate metabolism
    AKL17_0161
   00650 Butanoate metabolism
    AKL17_0161
  Lipid metabolism
   00071 Fatty acid degradation
    AKL17_0161
   00072 Synthesis and degradation of ketone bodies
    AKL17_0161
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AKL17_0161
   00310 Lysine degradation
    AKL17_0161
   00380 Tryptophan metabolism
    AKL17_0161
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AKL17_0161
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AKL17_0161
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AKL17_0161
Enzymes [BR:daa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AKL17_0161
Exosome [BR:daa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AKL17_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C Epimerase_2
Motif
Other DBs
NCBI-ProteinID: AMY67423
UniProt: A0A161GLD7
Position
complement(157264..158439)
Genome map
AA seq 391 aa AA seqDB search
MTNVVIVSAARTAVGSFNGAFATTPAHDLGAAVLDAVVARAGIEKSDVSETILGQVLTAG
QGQNPARQAHIKAGLPKESAAWSINQVCGSGLRAVALGAQHVMLGDAAIVAAGGQENMSL
SPHVAHLRAGYKMGDVSFIDSMIRDGLWDAFNGYHMGQTAENVANQWQITREMQDEFAVA
SQNKAEAAQKAGKFADEIIAFTIKTRKGDTVVDADEYIRAGATLESMTKLRPAFTKDGTV
TAGNASGLNDGAAAVILMSEEEAARRGLTPLARIASYATAGLDPSIMGVGPIHASRKALE
KAGWKAIDLDLVEANEAFAAQACAVNKDMGWNPEVVNVNGGAIAIGHPIGASGARILNTL
LFEMKRRGAKKGLATLCIGGGMGVAMCIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgtcgtaatcgtttcggcggcccgcacggccgttggcagcttcaacggggcc
tttgccaccactccggcccatgacctcggcgccgcggtgctggatgctgtggtcgcacgc
gccgggatcgagaaatccgacgtgtcggaaaccatcctcggccaggtgctcaccgccggt
cagggccagaacccggcccgccaggcgcatatcaaggccggcctgcccaaggaaagcgcc
gcctggtcgatcaaccaggtctgcggttcgggcctgcgtgccgttgcgcttggcgcgcag
catgtgatgctgggcgatgcggcaatcgtcgctgcgggcgggcaggaaaacatgtcgctc
tcgccccacgtcgcgcatctgcgcgccggctacaagatgggcgacgtgtccttcatcgat
tcgatgatccgcgacgggctctgggacgccttcaacggctaccacatgggccagaccgcc
gagaacgtggcgaaccagtggcagatcacccgcgagatgcaggacgaattcgccgtcgcc
agccagaacaaggccgaggccgcgcagaaggccggcaagttcgccgacgagatcatcgcc
ttcaccatcaagacccgcaagggcgacacggtggtggatgccgacgaatacatccgcgca
ggcgccacgcttgagtcgatgaccaagctgcgccctgccttcaccaaggatggcaccgtc
accgccggcaatgcctcggggctcaacgacggcgccgccgccgtgatcctgatgtccgag
gaagaggccgcccggcgtgggttgaccccgctggcccgcatcgcctcctatgccacggcc
gggctcgatccgtcgatcatgggcgtcggcccgatccatgccagccgcaaggcgctggaa
aaggccggctggaaggccatcgacctcgacctggtcgaagcgaacgaggcctttgccgcg
caggcctgcgcggtgaacaaggacatgggctggaatcccgaggtggtgaacgtcaacggc
ggcgccatcgccatcggccacccgatcggcgcctcgggcgcgcggatcctcaacaccctg
ctgttcgagatgaagcgccgcggggcgaagaagggccttgccacgctgtgcatcggcggc
ggcatgggcgttgcgatgtgcattgaagctctgtga

DBGET integrated database retrieval system