KEGG   Defluviimonas alba: AKL17_2252Help
Entry
AKL17_2252        CDS       T04387                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
daa  Defluviimonas alba
Pathway
daa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:daa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AKL17_2252
Enzymes [BR:daa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AKL17_2252
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AKL17_2252
    1.1.1.-  
     AKL17_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AMY69498
UniProt: A0A159Z543
Position
complement(2243275..2244348)
Genome map
AA seq 357 aa AA seqDB search
MKALRFHAARDLRIEDVVEPAAPAAGQVLIRNTFCGICGTDLHEYAHGPIFVPKEPHPFT
GAQGPQVLGHEFGGVVEAVGAGVTHVASGDRVSVQPLIMPRSGDYYSDRGLFHLSDQLAL
AGLSWHSGGMAERALLNDYNVVKIPDDLPDEAVALIEPAAVAVYACDRGGVFAGSSVLVT
GAGPIGVLALMAARAAGAVRLFVSDPNETRLALVRELLPDVVTLNPIRTRIGDAVRAATE
GGVGCDVAIECVGNEHALKACLDAVRKQGVVVQTGLHPHDNPLDWFAVTFKDVDLRGSWA
YPTHYWPRVAGMIASGALPAAKVVTRRIGLDEAITQGFDPLLDPAGTQLKILIDLSR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcccttcgtttccacgccgcccgtgacctgcgcatcgaggatgtggtcgagccc
gccgccccggcggcgggccaggtcctgatccgcaacaccttctgcggcatctgcggcacc
gacctgcacgaatatgctcatggcccgatcttcgtgcccaaggagccccatccctttacc
ggcgcccagggtccgcaggttctgggccacgaattcggcggcgttgtcgaggcggtgggc
gcgggggtgacgcatgtcgcctccggcgaccgggtctcggtccagccgcttatcatgccg
cggtcgggcgactactattccgatcgcgggttgttccacctctccgaccagctggccctg
gcgggcctctcgtggcattcggggggtatggcggaacgggcgctgctgaacgattacaac
gtcgtcaagatccccgacgacctgccagacgaagccgtggccctgatcgaaccggctgcc
gtcgccgtctatgcctgcgatcgcggtggggtctttgccggctcctcggtgctggtcacg
ggggcagggcccatcggtgtgctggcgctgatggctgcgcgggcggcgggcgcggtgcgg
ctgttcgtctccgatcccaacgagacgcgccttgcgctggtgcgcgagctgctgcccgat
gtcgtgacgctgaacccgatcagaacgcggatcggcgacgcagtgcgcgcggcgaccgag
ggcggggtgggctgcgatgtcgccatcgaatgcgtgggcaacgaacatgcgctcaaggcc
tgtcttgatgcggtgcgcaagcagggggtggtggtgcagaccgggctgcacccgcatgac
aacccgctggactggtttgccgtcaccttcaaggatgtggacctgcgcggcagctgggcc
tatccgacgcattactggccgcgcgtcgcgggcatgatcgcgtcgggcgccctgcctgcc
gcgaaggtggtgacccgccgcatcggactggacgaggcgatcacccaggggttcgacccg
ctgctggaccccgccggcacccagctgaagatcctgattgatctgtcgcgctga

DBGET integrated database retrieval system