KEGG   Defluviimonas alba: AKL17_3014Help
Entry
AKL17_3014        CDS       T04387                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
daa  Defluviimonas alba
Pathway
daa00450  Selenocompound metabolism
daa00970  Aminoacyl-tRNA biosynthesis
daa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AKL17_3014
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AKL17_3014
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:daa01007]
    AKL17_3014
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:daa03016]
    AKL17_3014
Enzymes [BR:daa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AKL17_3014
Amino acid related enzymes [BR:daa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AKL17_3014
Transfer RNA biogenesis [BR:daa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AKL17_3014
 Prokaryotic type
   Other AARSs
    AKL17_3014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AMY70248
UniProt: A0A159Z6U8
Position
2989234..2990952
Genome map
AA seq 572 aa AA seqDB search
MARILITSALPYINGIKHLGNLVGSQLPADLYARYMRGRGHEVMFICATDEHGTPAELAA
AKTGEAVDAYCARMHEVQADLARGFRLSFDHYGRSSSARNRALTQHFAGKLAENGFIEEH
SEKQVYSIADGRFLPDRYIEGTCPNCGYERARGDQCENCTKQLDPTDLINPRSAISGSTD
LEVRETKHLYLRQSLLKDEIDTWIDGQSDWPILTTSIAKKWLHDGDGLQDRGITRDLHWG
VPVKKGDAEWPGMEGKVFYVWFDAPIEYIGATAEWADATGKSDKDWERWWRSDKGAEDVR
YVQFMGKDNVPFHTLSFPATIMGSREPWKLVDYIKSFNYLNYDGGQFSTSQGRGVFMDQA
LSILPPDYWRWWLLSHAPESSDSEFTWENFQASVNKDLADVLGNFVSRITKFCRSKYGEV
VPEGGETGERAAALVVELETRVRAYETHMEAMEVRKAAAELRAIWAAGNEYLQSAAPWTV
VKTEPERAAAMVRLSLNLVRLYAVLSEPFIPDAAAMMLEAMGTADRSWPGDVAAALETLP
AGHAFTTPDNLFRKITDEEREDWEKRFSGIRS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcacggattctgattacctcggcactgccctacatcaacggcatcaagcatctgggc
aacctcgtcggcagccagttgcccgccgacctctatgcccgctacatgcggggccgcggc
catgaggtgatgttcatctgcgcgaccgatgagcacggcaccccggcagagcttgccgcc
gccaagaccggcgaggcggtggatgcctattgcgcccggatgcatgaggtacaggccgat
ctggcgcgcgggttccggctgtccttcgaccattacggccgctcctccagcgcccgcaac
cgcgcgctgacccagcatttcgccggcaagctggccgagaacggcttcatcgaggagcat
tcggaaaagcaggtctattccatcgccgatggccgcttcctgcccgaccgctatatcgag
ggcacctgcccgaactgcggctatgagcgggcgcgcggcgaccagtgcgagaactgcacc
aagcagctggacccgaccgacctcatcaacccgcgctcggccatttccggctccaccgat
ctcgaggtgcgcgagaccaagcatctctatctgcgccagtcgctgcttaaggatgagatc
gacacctggatcgacgggcaatcggattggccgatcctgaccacttcgatcgccaagaag
tggctgcatgacggcgacgggctgcaggaccgcggcatcacccgcgacctgcattggggc
gtgccggtgaagaagggcgacgcggaatggccggggatggagggcaaggtcttctatgtc
tggttcgatgcccccatcgaatatatcggcgccaccgccgaatgggccgatgcgaccgga
aagtcggacaaggactgggaacgctggtggcgctccgacaagggcgccgaggatgttcgc
tatgtgcaattcatgggcaaggacaacgtgcccttccacaccctcagcttccccgccacg
atcatggggtcgcgcgagccgtggaagctggtcgattacatcaagtcgttcaactacctg
aactatgatggcggccagttctcgaccagccagggccgcggcgtgttcatggatcaggcg
ctgtcgatcctgccgcccgattactggcgctggtggctgctgagccatgcccccgaaagc
agcgacagcgagttcacctgggagaatttccaggcctcggtgaacaaggatctggccgac
gttctgggcaatttcgtcagccgcatcaccaagttctgccggtccaaatacggcgaggtg
gtgcccgagggcggcgagacgggcgagcgggccgcggcgctggtcgtcgaactggaaacc
cgggtgcgcgcctatgaaacgcatatggaggcgatggaggtgcgcaaggccgcggccgag
ctgcgtgcgatctgggccgcgggcaacgaatacctgcaatcggccgcgccctggaccgtg
gtcaagacagagccggagcgggcggcagcgatggtgcggctgtcgctgaacctcgtgcgg
ctttacgcggtgctgtccgagcccttcatccccgacgccgccgcgatgatgctggaagct
atgggcaccgccgaccgcagttggccgggcgatgtggccgcggcactggaaaccctgccc
gctggccacgccttcaccacgccggacaacctgttccgcaagatcacggatgaagagcgc
gaggactgggaaaagcgcttctcgggcatccgcagctaa

DBGET integrated database retrieval system