KEGG   Defluviimonas alba: AKL17_3525Help
Entry
AKL17_3525        CDS       T04387                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
daa  Defluviimonas alba
Pathway
daa00072  Synthesis and degradation of ketone bodies
daa00280  Valine, leucine and isoleucine degradation
daa00650  Butanoate metabolism
daa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AKL17_3525
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AKL17_3525
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AKL17_3525
Enzymes [BR:daa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     AKL17_3525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AMY70749
UniProt: A0A161HCL9
Position
3503264..3503890
Genome map
AA seq 208 aa AA seqDB search
MWDRNQIAARAAKELQDGMYVNLGIGIPTLVSNYIPEGMTVTLQSENGMLGMGPFPTEDE
VDPDLINAGKQTITELPHSAYFDSAQSFAMIRGGKIAMAILGAMEVSEQGDLANWMIPGK
LVKGMGGAMDLVAGVGRVVVVMDHTNKAGESKVLKDCTLPLTGKAVVDRIITNMAVFDVV
PGGLKLLEVADGVTEEQVRAATEATIVD
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaccgcaaccagatcgctgcccgcgcggcgaaagagctgcaggacgggatgtat
gtgaaccttggcatcggcatcccgacgctggtgtcgaactacatccccgaaggcatgacc
gtgaccctgcaatcggaaaacgggatgctgggcatgggcccattccccaccgaggatgag
gtcgaccccgacctcatcaacgccggcaagcagaccatcaccgaactgccccactcggcc
tatttcgattctgcgcagagctttgccatgatccgcggcggcaagatcgcaatggcgatc
ctgggcgcgatggaggtgtccgagcagggcgacctggcgaactggatgatcccgggcaag
ctggtcaagggcatgggcggggcgatggatctggtggccggggtcggccgcgttgtggtg
gtgatggaccacaccaacaaggccggcgaatcgaaggtgctgaaggactgcaccctgccg
ctgaccggcaaggcggtggtggaccggatcatcaccaacatggcggtgttcgatgtggtc
ccgggcgggctgaagctgctcgaggtcgccgatggcgtcaccgaagagcaggtacgcgcc
gcgaccgaggccaccatcgttgactga

DBGET integrated database retrieval system