KEGG   Deinococcus actinosclerus: AUC44_07880Help
Entry
AUC44_07880       CDS       T04259                                 

Definition
(GenBank) aminotransferase class V
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
dab  Deinococcus actinosclerus
Pathway
dab00250  Alanine, aspartate and glutamate metabolism
dab00260  Glycine, serine and threonine metabolism
dab00630  Glyoxylate and dicarboxylate metabolism
dab00680  Methane metabolism
dab01100  Metabolic pathways
dab01110  Biosynthesis of secondary metabolites
dab01120  Microbial metabolism in diverse environments
dab01130  Biosynthesis of antibiotics
dab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AUC44_07880
  09102 Energy metabolism
   00680 Methane metabolism
    AUC44_07880
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AUC44_07880
   00260 Glycine, serine and threonine metabolism
    AUC44_07880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dab01007]
    AUC44_07880
Enzymes [BR:dab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     AUC44_07880
    2.6.1.45  serine---glyoxylate transaminase
     AUC44_07880
    2.6.1.51  serine---pyruvate transaminase
     AUC44_07880
Amino acid related enzymes [BR:dab01007]
 Aminotransferase (transaminase)
  Class V
   AUC44_07880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DFP
Motif
Other DBs
NCBI-ProteinID: ALW88826
UniProt: A0A0U4BZ44
Position
complement(1619264..1620409)
Genome map
AA seq 381 aa AA seqDB search
MLDATPEHILLTPGPTPIHPRAMQALTRPMLGHMDPEVFALNSEIQADLRAMYGATDSTF
TALLAGTGSLGMEAGFANLVEPGDEVLVCANGSFGHRMAEMAARYGARVRLVTAPLGEAI
NPDEVAARLDGVQMVAVVHGETSTGVLNPVPEIARLVQQSGALLTVDAVTTAGMEPFHMA
QWGVDYAYTGAQKCLSAPPGLAPVAISDRAFARFQARRTPTPLWYCDFQGLRDYWQDHSY
HHTVPVNLHYALHAALRAALDEGLEQRQRRVQQVGAAIQAALAPLGFTPYVRRPEDRLPT
VLALRLPDGLDDAGVRKALRARHISVTGGLGATAGQIWRLGLMGETARPAPYLTLMRALE
ELLGERGLADRFLTALDPVPA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgcgacccccgagcacatcctgctgacccccggccccacaccgatccacccc
cgggccatgcaggccctcacgcggccgatgctcggacacatggaccccgaggtgtttgcc
ctcaacagcgagatccaggccgatctgcgcgccatgtacggcgccacggacagcaccttc
accgcgctcctcgcaggcaccggcagcctgggcatggaagccgggttcgccaacctcgtg
gaacccggcgacgaggtgctcgtgtgcgccaacggatccttcgggcaccgcatggccgag
atggccgcccgctacggcgcccgcgtccgcctcgtgaccgcgccgctgggcgaggcgatc
aacccggacgaggtcgccgcgcgcctcgacggcgtccagatggtcgcggtcgtgcacggc
gagacgagcaccggcgtcctgaaccccgtccccgagatcgcccggctcgtccagcagagc
ggcgcgctgctgaccgtcgacgctgtcacgaccgccgggatggaacccttccacatggcg
cagtggggcgtggactacgcctacaccggcgcgcagaaatgcctcagcgccccccccggc
ctggcgcccgtcgccatcagtgaccgcgccttcgcgcgcttccaggcccggcgcaccccc
acgcccctgtggtactgcgacttccagggcctgcgcgactactggcaggatcactcctac
caccacaccgtcccggtcaacctgcattacgcgctgcacgccgcgctgcgcgccgcacta
gacgaaggcctggagcagcggcagcggcgcgtgcagcaggtcggcgcggccatccaggct
gccctggcgccgctgggcttcaccccctacgtgcgccgccccgaagaccgcctgcccacc
gtcctcgccctgcgcctgccggacggactcgacgacgccggcgtgcgtaaggccctccgc
gcgcggcacatcagtgtcaccggcgggctgggcgccaccgcaggccagatctggcgcctg
ggcctgatgggcgaaaccgcgcgccccgccccctatctgaccctcatgcgtgccctggag
gagctgctgggcgagcgcggcctcgcggaccgtttcctgacggccctggaccctgtgccg
gcctga

DBGET integrated database retrieval system