KEGG   Delftia acidovorans: Daci_0293Help
Entry
Daci_0293         CDS       T00620                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
dac  Delftia acidovorans
Pathway
dac00620  Pyruvate metabolism
dac00630  Glyoxylate and dicarboxylate metabolism
dac01100  Metabolic pathways
dac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Daci_0293
   00630 Glyoxylate and dicarboxylate metabolism
    Daci_0293
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     Daci_0293
    1.2.1.22  lactaldehyde dehydrogenase
     Daci_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ABX32939
UniProt: A9BQY4
Position
327356..328789
Genome map
AA seq 477 aa AA seqDB search
MASLPVLRNFIAGSFTDSAELHEVTNPATGAVLARSPLSSQADVDRAIAAARGAHKAWAR
RPAVERAQYLRRVAARIRDNAARIARTITEEQGKVLGLAEVEVNFTADYLDYMAEWARRI
EGEVITSDRANEQIFLLRKPLGVVAGILPWNFPFFLIARKMAPALLTGNTIVIKPSEETP
INCHAFTELLAQCELPAGVFNVVYGQGGTGAALAGHAGVDMVSFTGSVATGERIAAAAAP
HITKLNLELGGKAPAIVLADADLDLAVRAIRDSRITNTGQVCNCAERVYVQRQVADEFTA
RIAQAMAATRYGDPIARPDVEMGPLINQKGLDSVQAKVRQAIADGAQLVTGGQAADLGAG
FHFQPTVLAGCHAGMEIMRKEIFGPVLPIQVVEDLDEAIALANDCEYGLTSSLYTRDLSK
AMQAMREIDFGETYINRENFEAMQGFHAGVRKSGVGGADGKHGLYEYTHTHVVYLQG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcatcccttcccgtgctgcgcaatttcatcgccggcagcttcaccgacagcgccgaa
ctgcatgaggtgaccaaccccgccacgggcgcggtgctggcgcgctcgcccctgtccagc
caggccgatgtggaccgcgccattgccgctgcgcgcggcgcccacaaagcctgggcgcgc
cgcccggccgtggagcgcgcgcagtacctgcgccgcgtggcggcccgcatccgcgacaac
gccgcgcgcattgcgcgcaccatcaccgaggagcagggcaaggtcctgggcctggccgag
gtggaggtgaacttcaccgccgactatctggactacatggccgaatgggcgcgccgcatc
gagggcgaggtcatcaccagcgaccgggccaacgagcagatctttttgctgcgcaagcca
ctgggcgtggtcgcgggcatcctgccctggaactttcccttcttcctgatcgcccgcaag
atggcgccggccctgctcacgggcaacaccatcgtcatcaagcccagcgaggaaacgccc
atcaactgccatgccttcaccgagctgctggcccagtgcgagctgccggccggcgtgttc
aacgtggtctatggccagggcggcacgggcgctgcgctggccgggcatgcgggcgtggac
atggtcagcttcacgggcagcgtggccacgggcgagcgcatcgccgcagccgccgcgccc
cacatcaccaagctcaacctggagctgggcggcaaggccccggccatcgtgctggccgat
gccgacctggacctggccgtgcgcgccatccgcgactcgcgcatcaccaacaccgggcag
gtctgcaactgcgccgaacgcgtctacgtgcagcgccaggtggccgacgagttcacggcc
cgcatcgcccaggccatggcagccacgcgctacggcgacccgattgcgcggcccgacgtg
gaaatgggcccgctgatcaaccaaaagggcctggacagcgtgcaggccaaggtgcgccag
gccatcgccgacggcgcgcaactggtcacgggcgggcaggccgcagacctgggcgcgggc
tttcacttccagcccacggtgctggccggctgccatgccggcatggagatcatgcgcaag
gaaatcttcggccccgtgctgcccatccaggtggtggaggacctggacgaggccatcgcc
ctggccaacgactgcgaatacggcctgacctcgtcgctgtacacgcgcgacctgtccaag
gccatgcaggccatgcgcgagatcgacttcggggagacctacatcaaccgcgagaacttc
gaggccatgcagggcttccacgcgggcgtgcgcaagtccggcgtgggcggggccgacggc
aagcacggcctgtacgagtacacgcacacgcatgtggtgtacctgcaggggtga

DBGET integrated database retrieval system