KEGG   Delftia acidovorans: Daci_0434Help
Entry
Daci_0434         CDS       T00620                                 

Definition
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
dac  Delftia acidovorans
Pathway
dac02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dac00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Daci_0434
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dac02044]
    Daci_0434
Secretion system [BR:dac02044]
 Type IV secretion system
  Trb secretion system protein
   Daci_0434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4141 DUF948 ISG65-75
Motif
Other DBs
NCBI-ProteinID: ABX33080
UniProt: A9BPW1
Position
complement(464715..465440)
Genome map
AA seq 241 aa AA seqDB search
MKKRLVAAAIAAMLCTATAHAQWVVVDPTNLVQNTLTAIRTLEQINNQIQQLQNEAQMLM
NQARNLASLPSSVVGQLRANLATTQRLIDQARGLAYDVTNLDREFQRLYPEQYAATVSGD
QMYRDTQERWKNTLNGLQTTMRMQAQVSQNLGEDESVLADLVGKSQSAEGALQAMQAMNQ
LLALQAKQSIQSQRLQITQDRAAALELARQAAATERGREMTRRFLGSGTPYTPQAVDFYN
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcgtcttgtcgccgccgcaatcgcggccatgctttgcaccgccaccgcccat
gcgcaatgggtcgtggtcgatcccaccaacctcgtgcagaacacgctgaccgcgatccgc
acgctggagcagatcaacaaccagatccagcagcttcagaacgaagcgcagatgctgatg
aaccaggcgcgcaatctcgccagcctgccatccagcgtggtcggccagttgcgcgccaat
ctggcgaccacgcagcggctgatcgaccaggcgcgcggcctggcctacgacgtgacgaat
ctggatcgggagtttcagcgcctgtatcccgagcagtacgccgccacggtgagcggcgac
cagatgtaccgcgacacgcaggagcgatggaagaacacgctcaacggcttgcagaccacg
atgcggatgcaggcccaggtttcgcagaacctgggcgaagacgaaagcgtgctcgccgac
ctcgtgggcaagagccagtcagccgaaggtgcgttgcaggcgatgcaggccatgaaccag
ttgctggccttgcaggccaagcagtcgatccagtcgcagcggctccagatcacgcaggat
cgcgctgccgcgctggaactggcgcggcaggcggcggccacggagcgcggacgtgagatg
acgcgccgcttcctgggcagtggcacgccgtacacgccgcaagccgtcgatttctacaac
cactga

DBGET integrated database retrieval system