KEGG   Delftia acidovorans: Daci_0522Help
Entry
Daci_0522         CDS       T00620                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dac  Delftia acidovorans
Pathway
dac03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Daci_0522
Enzymes [BR:dac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Daci_0522
DNA repair and recombination proteins [BR:dac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Daci_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 AAA_22 PhoH AAA_28 DUF2075 UvrD-helicase Mg_chelatase AAA_16 AAA_5
Motif
Other DBs
NCBI-ProteinID: ABX33168
UniProt: A9BRB0
Position
562874..565081
Genome map
AA seq 735 aa AA seqDB search
MSPRPRSRTVDTATLDLFDERPGDDSPGGETPGDASLGGKPPGAVPPDTNELLALLRRWA
DAGLLRRLDAALASFVAGQDAQAGPALLVAAALLAQMEGRGHSCLPLAPLAGNPNDVLAW
PAEALPAQQALWQILPARLSGWVAALGASPVVRVVGDAGQDGGEDLGQPLVLAGADGPAP
LLYLRRYWDYERAVAIHVIQRTAVQAVAAQPLDEALARHWLDRLFPPAAGGGPVDWQKLA
CALALRGRLSVITGGPGTGKTYTAARLLALLFATAPDAGQLRVALAAPTGKAAARLKQSI
DGALLQLQGSMGGEIDLAGLVQRMGAARTLHSMLGARPDTRHWGFHAGRQLDVDVLIVDE
ASMVHLEMMAALLEALPAGARLVLLGDKDQLASVEAGAVLGDLCRDAQAGRYLPDTLDYA
LRVADQAVPPQFAAPAGDRPPALAQHTVMLRESRRFGGPIGQLARAVNAGHAAQAQALLD
AGTQGGTHSELWERQGGGVQAVTELAVGGRGGLASYALYARALQNRPAADGDYEAAHRAW
VIDVLQAFERFRLLCAVREGDWGVSGLNRAVEQALEAQGAIRRSGEWYAGRPVMVTRNDA
QLGVFNGDIGIALPGGSQGGSHGGSQGGPQGGPGQPLRVYFLQGDELRSVGVSRLAHVET
AFAMTVHKSQGSEFEHTALVLPSRGGSVLGRELVYTGITRARQAFSLFSEVPGLLASAVG
SPTQRASGLLRWLQD
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcgcccccgttcgcggaccgtcgatacggccacgctggatctgttcgacgaa
cggccgggcgacgactcgccgggcggcgaaacgccaggcgacgcatcgctgggcggcaaa
ccgccgggcgccgtgccgccagacaccaatgaactgctggccctgctgcgccgctgggcc
gatgccggcctgctgcggcgcctggatgcggcgctggcctcattcgtcgccgggcaggat
gcgcaggccgggcccgccttgctggtggcggccgcgctgctggcgcagatggaggggcgc
ggccacagctgcctgcccctggcaccgctggccggcaaccccaacgacgtgctggcctgg
cccgccgaggcgctgcccgcgcagcaggccctgtggcagatactgcccgcgcgcctgtcc
ggctgggtggctgcgctgggtgccagccccgtggtgcgcgtggtcggcgacgcgggccag
gatggcggcgaggaccttggccagcccctggtgctggccggtgccgacggccccgcgccg
ctgctgtacctgcgccgctactgggactacgagcgcgccgtggccatccatgtcatccag
cgcacggcggtgcaggccgtggccgcccagccgctggacgaagccctggcccgccactgg
ctggaccgcctgttcccgcctgcggcgggaggcggccccgtggactggcagaagctggcc
tgcgcgctggcgctgcgcggccggctgtcggtgatcacgggcggccccggcaccggcaag
acctataccgccgcgcggctgctggccctgctgtttgccacggcgcccgacgccggccag
ctgcgcgtggccctggccgcccccacgggcaaggcggctgcgcgcctgaagcaatcgatt
gacggggccttgctgcaattgcagggcagcatgggcggcgagatcgacctggcgggcctg
gtgcagcgcatgggcgcggcgcgcaccctgcactccatgctgggcgcgcggcccgatacg
cggcactggggattccatgcgggccggcaactggacgtggatgtcctcatcgtcgatgag
gcctccatggtccacctggagatgatggcggcgctgctggaggcactgccggccggcgcc
cgcctggtgctgctgggcgacaaggaccagctggcatcggtggaggcgggcgccgtgctg
ggcgacctgtgccgcgatgcccaggccggacgctacctgccggacacgctggactacgcg
ctgcgcgtggccgaccaggcggtgccgccgcagttcgcggcgccggcaggcgaccgtcct
ccggctcttgcacagcacaccgtcatgctgcgcgaaagccggcgcttcggtggccccatc
ggccagttggcgcgcgccgtgaatgccggccacgccgcgcaggcccaagccttgctcgat
gccggcacgcaaggcggtacgcactccgaactctgggagcgccagggcggcggcgtgcag
gccgtgaccgaactggccgtgggtgggcgtggcggcctggccagctatgcgctgtatgcc
agggcgcttcaaaacaggccggctgcggacggcgactacgaggccgcgcaccgggcctgg
gtgatcgatgtgctgcaggccttcgagcgcttccggctgctgtgcgccgtgcgcgagggg
gactggggcgtgtccggcctcaaccgggcggtggagcaggccctggaagcgcagggcgcc
atccgccgcagcggcgaatggtatgcgggccggcccgtcatggtcacgcgcaacgatgcg
cagctgggcgtgttcaacggtgacatcggcattgcgctgccgggtgggtcgcagggcggg
tcgcatggcgggtcacaggggggcccgcagggtgggcccgggcagccgctgcgcgtgtac
ttcctgcagggtgacgagctgcgctcggtcggtgtcagccgcctggcccatgtggagacc
gccttcgccatgacggtgcacaagagccagggctcggagttcgagcacacggccctggtg
ctgccctcgcgcggcggcagcgtgctggggcgcgagctggtctacaccggcatcacgcgc
gcccgccaggccttctcgctgttctccgaggtgccgggcctgctggcctcggccgttggc
agccccacgcagcgcgccagcgggctgttgcgctggctgcaggactga

DBGET integrated database retrieval system