KEGG   Delftia acidovorans: Daci_0721Help
Entry
Daci_0721         CDS       T00620                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Daci_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF11 PapD-like
Motif
Other DBs
NCBI-ProteinID: ABX33367
UniProt: A9BRK6
Position
complement(799080..799550)
Genome map
AA seq 156 aa AA seqDB search
MGGGAWGRSQAGTLRAVTIAAMPMNEFQVQVRPAFLPEQSAPAAGVYAFSYTITVTNTGQ
VPGQLIARHWIITNELGHVEEVKGLGVIGRQPLLQPGETFEYTSGCQLRTPNGSMQGSYL
CISHEGEVFECPIPRFHLQSGAGGDSFPDPDNRVLH
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcggcgcgtgggggcgttcgcaagccggtacattgcgggcagttaccattgcc
gccatgcccatgaacgagttccaggtccaggtccgccccgcctttttgccagagcaatcc
gctccagcggcgggcgtatacgccttctcctacacgatcaccgtgaccaataccggccag
gtgccgggccagttgatcgcgcgccactggatcatcaccaacgaactgggccatgtcgaa
gaggtcaagggcctgggggtgatcggccgccagccgctgctgcagcccggcgagaccttc
gagtacaccagcggctgccagctgcgcacgcccaacggcagcatgcagggcagctatctg
tgcatcagccacgagggcgaggtcttcgagtgccccatcccgcgctttcatctgcagtcg
ggcgctggcggcgacagctttccagaccctgacaaccgcgtgctgcactga

DBGET integrated database retrieval system