KEGG   Delftia acidovorans: Daci_0935Help
Entry
Daci_0935         CDS       T00620                                 

Definition
(GenBank) fructose-bisphosphate aldolase, class II, Calvin cycle subtype
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
dac  Delftia acidovorans
Pathway
dac00010  Glycolysis / Gluconeogenesis
dac00030  Pentose phosphate pathway
dac00051  Fructose and mannose metabolism
dac00680  Methane metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01130  Biosynthesis of antibiotics
dac01200  Carbon metabolism
dac01230  Biosynthesis of amino acids
Module
dac_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daci_0935
   00030 Pentose phosphate pathway
    Daci_0935
   00051 Fructose and mannose metabolism
    Daci_0935
  09102 Energy metabolism
   00680 Methane metabolism
    Daci_0935
Enzymes [BR:dac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Daci_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase OST_P2 TFA2_Winged_2
Motif
Other DBs
NCBI-ProteinID: ABX33581
UniProt: A9BQH1
Position
1045819..1046931
Genome map
AA seq 370 aa AA seqDB search
MRQGHPPLNNLIRTLHMPLVSMRELLDHAAENGYGLPAFNVNNLEQVQAVMSAADEVGAP
VILQASAGARKYAGEPFIKHLIQAAAEQYPHIPLVMHQDHGTSPAICQGALNLGFGSVMM
DGSLMEDGKTPSSFEYNVDVTRKVVEMAHKLGATVEGELGCLGSLETGMAGEEDGVGAEG
VLDHSALLTDPEEAAQFVKATQLDALAIAIGTSHGAYKFTRKPTGDILSIQRVKEIHARL
PNTHLVMHGSSSVPQELLEIIRQYGGAMKETYGVPVEEIQEAIKHGVRKINIDTDIRLAM
TGAVRKFLAENPEKFDAREWLKPAREAAKQICKARYIEFGCEGQGAKIKGYTLEQMAAKY
AAGSLQQVVN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaggggcatccccctctcaacaacttgatacggaccctacacatgcctctcgtt
tcgatgcgcgaactgctggaccacgctgccgaaaacggctacggtcttcccgccttcaac
gtcaacaacctggagcaggtgcaagccgtgatgtcggccgcagacgaagtgggcgcgccc
gtcatcctgcaggccagcgcaggcgcccgcaagtacgccggcgagcccttcatcaagcac
ctgatccaggccgctgccgagcagtatccccacattcccctggtcatgcaccaggaccac
ggcacctcgcccgccatctgccagggcgcgctgaacctgggcttcggctcggtgatgatg
gacggctcgctgatggaagacggcaagacgccttcctccttcgaatacaacgtggacgtg
acccgcaaggtcgtggaaatggcccacaagctgggcgccaccgtcgaaggtgaactcggc
tgcctgggctcgctggaaaccggcatggccggcgaggaagacggcgtgggcgccgaaggc
gtgctcgaccactcggcgctgctgaccgaccccgaggaagcggcccagttcgtcaaggcg
acgcagctggacgcgctggccattgccatcggcaccagccacggcgcctacaagttcacg
cgcaagcccacgggcgacatcctgtccatccagcgcgtcaaggaaatccacgcgcgcctg
cccaacacccacctggtcatgcacggctcctcctccgtgccccaggaactgctggaaatc
atccgccagtacggcggcgccatgaaggaaacctacggcgtgcccgtcgaggaaatccag
gaagccatcaagcacggcgtgcgcaagatcaacatcgacaccgacatccgcctggcgatg
accggcgccgtgcgcaagttcctggccgagaaccccgaaaagttcgatgcccgcgaatgg
ctcaagcctgcccgcgaagccgccaagcagatctgcaaggcccgctacatcgagttcggc
tgcgaaggccagggcgccaagatcaagggctacacgctggagcagatggctgccaagtac
gctgccggttcgctgcagcaggtcgtgaactga

DBGET integrated database retrieval system