KEGG   Delftia acidovorans: Daci_1288
Entry
Daci_1288         CDS       T00620                                 

Definition
(GenBank) glycyl-tRNA synthetase, alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
dac  Delftia acidovorans
Pathway
dac00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dac00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Daci_1288
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dac01007]
    Daci_1288
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dac03016]
    Daci_1288
Enzymes [BR:dac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Daci_1288
Amino acid related enzymes [BR:dac01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Daci_1288
Transfer RNA biogenesis [BR:dac03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Daci_1288
SSDB
Motif
Pfam: tRNA-synt_2e
Other DBs
NCBI-ProteinID: ABX33932
UniProt: A9BXZ7
Position
1434077..1435015
AA seq 312 aa
MLTFQQIILKLQSYWADQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP
KDGRYGDNPNRLQHYYQFQVVLKPAPDNILELYLGSLEALGFDLKKNDIRFVEDDWENPT
LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLERLAMYLQGVDNVYNLTW
TDGLSYGDVYHQNEVEQSTYNFEHSDADFLFTAFGAYEKQANHLIGEQLALPAYEQVLKA
AHTFNLLDARGAISVTERAAYIGRIRNLARAVAKAYMDSRARLGFPMAPKAHADEVLAEL
AKAAEQQGKKAA
NT seq 939 nt   +upstreamnt  +downstreamnt
atgctcactttccaacaaatcatcctcaagctgcagtcctactgggccgaccagggctgc
gcactgctccagccctatgacatggaagtgggcgcgggcacctcgcacaccgccaccttc
ctgcgcgcgctgggccccgagccctggaaggccgcctacgtgcagcccagccgccgcccc
aaggacggccgctatggcgacaaccccaaccgcctgcagcactactaccagttccaggtg
gtgctcaagcccgcgcccgacaacatcctggagctgtacctgggctcgctcgaagccctg
gggttcgacctgaagaagaacgacatccgcttcgtcgaggacgactgggagaaccccacg
ctgggcgcctggggcctgggctgggaagtctggctcaacggcatggaggtgacgcagttc
acctacttccagcaggtcggcggcatcgactgcaagcccgccacgggcgagatcacctac
ggcctggagcgcctggccatgtacctgcagggcgtggacaacgtctacaacctgacctgg
accgacggcctgagctacggcgacgtctaccaccaaaacgaggtggagcagtccacctac
aacttcgagcattcggacgccgacttcctgttcaccgccttcggcgcctacgaaaagcag
gccaaccacctgatcggcgaacagctggcgctgccggcctacgagcaggtgctcaaggcc
gcccacaccttcaacctgctcgatgcgcgcggcgccatcagcgtgacggagcgtgccgcc
tacatcggccgcatccgcaacctggcccgcgccgtggccaaggcctatatggacagccgt
gcacgcctgggcttccccatggcgcccaaggcccatgccgacgaagtgctggccgagctg
gccaaggccgccgaacaacagggcaagaaggccgcctga

DBGET integrated database retrieval system