KEGG   Delftia acidovorans: Daci_2426Help
Entry
Daci_2426         CDS       T00620                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dac  Delftia acidovorans
Pathway
dac00020  Citrate cycle (TCA cycle)
dac00190  Oxidative phosphorylation
dac00650  Butanoate metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01130  Biosynthesis of antibiotics
dac01200  Carbon metabolism
Module
dac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dac_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Daci_2426
   00650 Butanoate metabolism
    Daci_2426
  Energy metabolism
   00190 Oxidative phosphorylation
    Daci_2426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABX35064
UniProt: A9BVJ7
Position
complement(2681790..2682155)
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRTVVGAHYGIRDWMVQRVTGVLMALFTIVLLAKLIFSTGSVGYDLWAGIFAP
QWMKFLTFAVIVSLAWHVWVGVRDIWMDYVKPVGLRLVLNVFTLVWLVGCAGWGIQILWR
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaattacggctccaagcgcaccgtggtcggtgcgcactacggcatccgcgac
tggatggtgcagcgcgtcaccggcgtgctgatggcactgttcaccatcgtgctgctggcc
aagctgatcttcagcaccggctccgtcggctatgacctgtgggccggcatctttgccccg
cagtggatgaagttcctgaccttcgccgtgatcgtctcgctggcctggcacgtctgggtc
ggcgtgcgcgacatctggatggactacgtcaagcccgtgggcctgcgcctggtgctgaac
gttttcaccctggtctggctcgtcggctgcgccggctggggcatccagatcctgtggcgt
atctga

DBGET integrated database retrieval system