KEGG   Delftia acidovorans: Daci_2690
Entry
Daci_2690         CDS       T00620                                 

Definition
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
dac  Delftia acidovorans
Pathway
dac02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dac00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Daci_2690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dac02044]
    Daci_2690
Secretion system [BR:dac02044]
 Type IV secretion system
  Trb secretion system protein
   Daci_2690
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ABX35328
UniProt: A9BTR4
Position
complement(2959059..2960327)
AA seq 422 aa
MSQDDSPDLAAQAGKVAPEAVALRAQPRPVTRLNRRTLAILVGVLSVAVLGATIWSLQPH
RRGTGEQTELYNVDRVSKSEGLDGLPADYSKLPPKVPELGPPLPGDLGPAIVKSQQPVTP
AYAQPGHDPADAWRKEADAAANSSVFFRSGNQGKATAPVTAQAAAAAPGSALAGFDPLAA
GPASTAAQPSDPTAVQNRQDQKEAFLKGGSTETRNSGNLQMPASPYQVMAGTVIAGALVT
GIKSDLPGDVIATVTEPVYDTATGKFLLIPQGSRILGKYNSQVSYGQSRVQVVWNRVILP
DTSSLKLDNLAGTDPAGYSGLEDGVDWHWDRVFAGAALTTLLGVGAELAAPENRQDGNRI
VIAGRDSAQDSINQVGQEMTRRNMNIQPTLTERPGLPVRIIVNRDFVLRPYQPMFFNRGI
AK
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagccaggacgattcccctgatcttgcggcgcaggcgggcaaggtcgcgcccgaggcg
gtggcgctgcgcgcccagccgcgcccggtcacgcgcctgaaccggcgcacgctggccatc
ctcgtcggcgtcctgtcggtcgccgtgctcggggccacgatctggtcattgcagccgcac
cggcgcggcacgggcgagcagaccgagctttacaacgtcgatcgcgtctcgaagtccgag
gggctggatggtctgccggccgactactcgaagctgccgccgaaggtgcccgagctgggg
ccgccgctgccgggtgatctcggcccagccatcgtgaagtcgcagcagccggtgacgccg
gcctacgcacagccgggacatgatccggcggatgcatggcgcaaggaggccgatgcggcg
gcgaactcgtcggtgtttttccgctcgggcaaccaaggcaaggccaccgcgccggtcacg
gcgcaagccgctgcggctgcgcccggcagcgccttggcgggcttcgacccgctggccgct
ggcccggcctcgacggcggcccagccatccgacccgacagccgtgcagaaccggcaagac
cagaaagaggctttcctgaaaggcggttctacggaaacccgcaattccggcaatctccag
atgccggcctcgccgtatcaggtcatggcgggaacggtgatcgcgggcgcgctggtgacg
ggcatcaagtccgatctgccgggcgacgtgatagccacggtgacggagccggtctatgac
acggccactggcaagttcctgctgatcccacagggatcgcgcatcctgggcaagtacaac
agccaggtgagctacgggcagagccgcgtacaggtggtgtggaaccgcgtcatcctgccg
gacacgtcctcgctgaagctagacaacctggcgggcactgaccctgccggctattccggc
ctggaggatggcgtcgattggcattgggatcgcgtcttcgcgggtgcggcgctgacgacc
ctgctgggcgtgggtgccgagttggccgcaccggaaaaccggcaggatggcaaccgcatc
gtgatcgctgggcgcgatagcgcgcaggacagcatcaaccaggtcggccaagagatgacc
cggcgcaacatgaacatccagccgacgctgaccgagcggccgggcctgccggtgcggatc
atcgtcaaccgcgattttgtgctgcggccgtaccagcctatgttcttcaaccgtggaatt
gcgaaatga

DBGET integrated database retrieval system