KEGG   Delftia acidovorans: Daci_2696
Entry
Daci_2696         CDS       T00620                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
dac  Delftia acidovorans
Pathway
dac02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dac00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Daci_2696
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dac02044]
    Daci_2696
Enzymes [BR:dac01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Daci_2696
Secretion system [BR:dac02044]
 Type IV secretion system
  Trb secretion system protein
   Daci_2696
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 HerA_C AAA_22 TraG-D_C AAA_16 Zot AAA_29 CbiA
Other DBs
NCBI-ProteinID: ABX35334
UniProt: A9BTS0
Position
complement(2964490..2966961)
AA seq 823 aa
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSA
RLNNALRRLGSGWALFIEAERRSAADYPHSDFPEPLSWLVDEERRAAFEDSGNHFESGYH
LTLAYLPSEESRARAAGLLYENRPTEGVDWRERLHAFVAETDRIFDLLDGVMPEIAWLDD
SQTLTYLHSTVSTRRYRVGVPEVPFHIDALLTDSALVGGLAPMLGDQHLRVVSVRGFPTS
TWPGILDDLNRLGFAYRWSTRFLCLDKAEAEKELARLRRQWFAKRKNVIALLRETIFQQE
SPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDADAAVADEKLRMVERVIQGR
GFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPVSAVWAGQERNAHLDGPP
LIVTRTDGATPFRLVTHIGDVGNTLVVGPIGMGKSVLLATMAMQFRRYRGSRIFAFDMGR
SIRAAILGMGGEHYDLGADDEIAFQPLARIDREGYRTWASEWVEGRLLHEGAAVGPDEKA
AIWSALGSLASAPVEQRTLTGLTALLQSNTLRQALAPYVLGGAHGRLLDADHDRLGTSDV
QAFEMEELMHSKAAVLAVLRYLFARFEERLDGAPTLLILDEAWLFLDDPVFAARIRQWLK
TLRKKNVSVIFATQSLADVKDSAIAPAIIESCASRIFLPNPQATEPQIRTIYEGFGLNSR
QIEIVATAQPKRDYYYQSRLGNRVFDLDLGPATLAFAGASTPQDQRAIDEVLGRVPQDAG
VPGFAGAWLRHRGLDWAADLLPSFPGLTPDSLRTADHPQENLP
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgctgaacctcgccgaataccgccagcgaccggccttgctcgccgactggctgccctgg
gccggactggtggcaccgggcgtcgtcttgaacaaggacggcagtttccagcgcacggcg
cgctttcgtggccccgacctcgacagcgcgacgcaaggcgagctgatcgccacatcggcg
cgcttgaacaacgcgctgcgccgcctgggttcgggctgggcgctgttcatcgaagccgag
cgccggtctgccgccgactacccgcactccgatttccccgaaccgctgtcctggctggtc
gatgaagaacgccgcgccgccttcgaggattcgggcaaccacttcgagagcggctatcac
ctgacgctggcctacctgccgtccgaggaatcccgtgctcgggccgcgggcctgctgtac
gaaaaccggcccaccgaaggcgtggattggcgcgagcggctgcacgccttcgtcgctgaa
acggatcgcatcttcgacctgctcgatggcgtgatgccggagatcgcctggcttgatgac
agccagacgttgacctacctgcattcgaccgtctcgacgcgccgctaccgcgtcggcgtt
cccgaagtgccgttccacatcgacgcgctgctgaccgattccgcgctggtcggtggcctg
gcgccgatgctgggcgaccagcacctgcgcgtggtgtcggtgcgcggtttcccgacctcg
acctggccggggattctggacgacctcaaccgcctgggcttcgcgtatcgctggagtacg
cgctttctgtgcctcgacaaagccgaggcggaaaaagaactcgcccgactgcgccgccag
tggtttgcgaaaaggaagaacgtcatcgcgttgctgcgcgagacgatcttccagcaggaa
agcccgctggtcgataccgacgccaacaacaaggccgccgacgccgatgctgccttgcag
gagctgggcagcgatcaggtcgccttcggctacctgacggcgaccgtcaccgtcatggac
gcggacgccgccgttgccgacgagaagctgcgcatggtggagcgcgtcatccaggggcgc
ggcttcgtcaccatccccgaaacgctcaacgccgtggatgcgtggctgtcgtccattccg
ggcaacgcatacgccaatgtccgccagcccatcgtctcgacgctgaacctggcgcacatg
atgccggtgtcggcggtatgggccggccaggaacgcaatgcgcatctcgatgggccgccg
ctgatcgtcacgcgcacagacggcgccacgccgttccggctggtgacgcacatcggcgac
gtgggcaacacgctggtggttggccccatcggcatgggcaagtcggtgctgctggcgacg
atggcgatgcagttccgccgctatcgcggctcgcgcatcttcgccttcgacatggggcgc
tcgatccgcgcggccatcctgggcatgggcggcgagcactacgacctgggcgcggacgac
gagatcgccttccagccgctggcgcgcatcgaccgagagggctaccgcacctgggccagc
gaatgggtggaaggccgcctgctgcacgaaggcgcggccgtcggcccggacgagaaggcg
gccatctggtctgcgctggggagcctggccagcgcgccggtggagcagcgcacgctcacg
ggcctgacggccttgctgcaatcgaacaccttgcgccaggcactcgcgccctacgtcctg
ggcggcgcgcacggcaggctgctggatgccgaccacgaccgcctcggcacatccgacgtg
caggcgttcgagatggaggagctgatgcacagcaaggctgctgtgctcgcggtgctgcgc
tacctgttcgcgcgcttcgaggagcggctggatggtgcgcccacgctgctgatcctcgat
gaagcctggctgttcctcgatgacccggtgtttgcggcgcgcatccgccagtggctcaag
acgctgcgcaagaagaacgtcagtgtcatcttcgccacgcagtcgctcgcggacgtgaag
gattcggccatcgcgccggccatcatcgaaagctgcgcgagccggattttcttgccgaac
ccgcaagcgaccgaaccgcagattcgcacgatctacgagggcttcggcctcaacagccgg
cagatcgagatcgtcgccactgcgcaacccaagcgcgactactactaccaatcccgcctc
ggcaaccgcgtgttcgacctcgacctggggccggcgacgctggccttcgcgggcgcttcc
acgccacaagaccagcgcgccattgatgaagttcttggccgcgtgccgcaggacgccggc
gtgcccggcttcgcgggcgcctggctgcgccatcgcggcctcgattgggcggcagacctg
ctgccctcgttccccggcctcacgccggattccctccgtaccgctgaccacccccaggag
aacctgccatga

DBGET integrated database retrieval system