KEGG   Delftia acidovorans: Daci_2938Help
Entry
Daci_2938         CDS       T00620                                 

Definition
(GenBank) phosphopantetheine-binding
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
dac  Delftia acidovorans
Pathway
dac00473  D-Alanine metabolism
dac01100  Metabolic pathways
dac01503  Cationic antimicrobial peptide (CAMP) resistance
dac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Daci_2938
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Daci_2938
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Daci_2938
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:dac01504]
    Daci_2938
Enzymes [BR:dac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     Daci_2938
Antimicrobial resistance genes [BR:dac01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    Daci_2938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding HTH_33
Motif
Other DBs
NCBI-ProteinID: ABX35576
UniProt: A9BZH6
Position
complement(3228018..3228257)
Genome map
AA seq 79 aa AA seqDB search
MSLNDIETKIAQIIGAIILTSVEPDTLLLESGLVDSLSAVDVALAIEKEFGVKIPPSEID
LHLESVHTLAQYVAEQRKA
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgaatgacatcgaaaccaagattgcccagatcatcggcgccatcatcctgacc
tcggtcgagcccgatacgctgctgctcgaatcgggcttggtggactcgctgtccgccgtg
gacgtggcactggccatcgaaaaggagttcggtgtcaagataccgccatcggagatcgac
ctgcacctggaatccgtgcacacgctggcgcagtacgtggccgagcagcgcaaggcctga

DBGET integrated database retrieval system