KEGG   Delftia acidovorans: Daci_2959Help
Entry
Daci_2959         CDS       T00620                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
dac  Delftia acidovorans
Pathway
dac00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Daci_2959
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Daci_2959
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Daci_2959
    1.1.1.-  
     Daci_2959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABX35597
UniProt: A9BZJ7
Position
3259818..3260939
Genome map
AA seq 373 aa AA seqDB search
MGRLCRPPTQPCKTESSIMKAARFYDRGDIRIEDIPEPVVEPGTVGIEVAWCGICGTDLH
EFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGAGVDDIKVGQHVVVEPYIVAD
DVPTGPGDHYHLSKDMNFIGLGGRGGGLSERIAVKRRWVHPISNAIPLDQAALIEPLSVG
HHAYTRSGAKAGDVALVGGAGPIGLLLSAILKAKGLTVVITELSAKRKQKARESGVADHI
LDPSEVDVVAEVMKLTGGKGVDVSFECSSVNKVLDTLVAVTKATGVVVIVSIWSHPATIN
VHSVVMKELDVRGTIAYCNDHQETIKLVEEGKINLEPFITQRIQLDDLVAQGFDTLIHNN
ESAVKIIVQPRLR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggggcggctgtgccgcccgccaacccagccttgcaaaacagaaagttcaatcatgaaa
gcagcacgtttctacgaccggggcgacatccgcatcgaagacatccccgaacccgtggtg
gagcccggcaccgtgggcatcgaggtggcctggtgcggcatctgcggcacggatttgcat
gagttcatggaagggccgatcttcattccgccctgcggccatccgcaccccatctcgggc
gagtccgcacccatcaccatggggcacgagttctccggcgtggtgtacgccgtgggcgcg
ggcgtcgacgatatcaaggtcggccagcacgtcgtggtggagccctacatcgtggccgac
gacgtgcccacggggccgggcgaccactaccacctgtccaaggacatgaatttcatcggc
ctgggcgggcgtggcggcgggctgtccgagcggattgcggtcaagcgccgctgggtgcac
ccgatctccaatgccattccactggaccaggccgcgctgatcgagccgctgtccgtgggc
caccatgcctacacccgcagcggagcgaaggcgggtgatgtggcgctggtcggcggcgca
ggccccatcggcctgctgctgtccgccatcctgaaggccaagggcctgacggtggtcatc
accgaactgagcgccaagcgcaagcagaaggcgcgtgaatcgggcgtggccgatcacatc
ctggacccctccgaagtggacgtggtggccgaggtgatgaagctcaccggcggcaagggc
gtggatgtgtcgttcgaatgctccagcgtgaacaaggtgctggacacgctggtggccgtg
acgaaggccacgggcgtggtggtgatcgtgtccatctggagccatccggccaccatcaac
gtgcacagcgtggtcatgaaggagctggatgtgcgcggcaccattgcctactgcaacgac
caccaggaaaccatcaagctggtcgaggagggcaagatcaacctcgagcccttcatcacc
cagcgcatccagctcgatgacctggtggcgcagggcttcgacacgctgattcacaacaac
gaatcggcggtgaagatcatcgtgcagccacggctcaggtag

DBGET integrated database retrieval system