KEGG   Delftia acidovorans: Daci_3183
Entry
Daci_3183         CDS       T00620                                 

Definition
(GenBank) periplasmic binding protein/LacI transcriptional regulator
  KO
K10439  ribose transport system substrate-binding protein
Organism
dac  Delftia acidovorans
Pathway
dac02010  ABC transporters
dac02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Daci_3183
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Daci_3183
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dac02000]
    Daci_3183
Transporters [BR:dac02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Daci_3183
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Glyco_trans_1_4 DUF1232
Other DBs
NCBI-ProteinID: ABX35821
UniProt: A9BW05
Position
complement(3504276..3505202)
AA seq 308 aa
MDRNTFLRRMLAGAFTFGLPASPALAQPGPGPSPARTIGVSLLTQQHPFYLELAQAMQQE
AARQGLKLDLSIANQDLGKQISDVEDFVSKKVDAIILSPVDSRGVKAAVLKAAAARIPVI
TVDIAASGVEVASHVATDNRAGGVLAGQLMGRATGGKGQIGVLHYPSIQSVVDRVEGFKA
AIATFPGMKIVSVQPGITRAEALAASQNMLQAHPDLAGIFGFGDDAALAALASVKGAKKL
EQVKIVGFDGMAEARAAVDREPAFVGVIRQYPDQLGLQAVAIAAQLLSGKPVEKFHPVLP
GVYTAAAR
NT seq 927 nt   +upstreamnt  +downstreamnt
atggaccgcaacacgtttctccggcgcatgctggccggcgcattcacattcggcctgccg
gccagcccggcgcttgcacagccgggccccggccccagccctgcccgcaccatcggcgtg
tccctgctcacgcagcagcacccgttctacctggagctggcccaggccatgcagcaggaa
gccgcgcggcaggggctgaagctggacctgagcattgccaaccaggacctgggcaagcag
atctccgatgtggaggacttcgtcagcaagaaggtcgatgccatcatcctgtcgcccgtg
gattcacgcggcgtgaaggccgccgtgctcaaggctgccgccgcccgcattcccgtgatc
accgtggacattgcagccagcggggtcgaggtcgcatcgcacgtggccaccgacaaccgc
gccggcggcgtgctggccggccagctcatgggtcgggccaccggcggcaagggccagatc
ggcgtgctgcactacccgtccatacagtccgtggtcgatcgcgtggagggtttcaaggcc
gccatcgccaccttccccggcatgaagatcgtctccgtgcagccgggcatcacgcgggcc
gaggccctggccgcttcgcagaacatgctgcaggcccaccccgatctcgcgggcatcttc
gggtttggcgacgacgcggccctggctgcactggccagcgtcaagggcgcaaaaaagctg
gagcaggtcaagatcgtcggctttgacggcatggccgaggcgcgcgcggccgtggaccgc
gaaccagcctttgtgggcgtgatccgccagtaccccgaccagttgggactgcaagccgtg
gccattgccgcgcagctgctgtcgggcaagccggtggaaaaattccaccccgtgttgccc
ggcgtgtacacggctgccgccagatag

DBGET integrated database retrieval system