KEGG   Delftia acidovorans: Daci_3315Help
Entry
Daci_3315         CDS       T00620                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain protein
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
dac  Delftia acidovorans
Pathway
dac00071  Fatty acid degradation
dac00280  Valine, leucine and isoleucine degradation
dac00410  beta-Alanine metabolism
dac00640  Propanoate metabolism
dac00650  Butanoate metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01130  Biosynthesis of antibiotics
dac01200  Carbon metabolism
dac01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Daci_3315
   00650 Butanoate metabolism
    Daci_3315
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Daci_3315
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Daci_3315
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Daci_3315
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Daci_3315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_C Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N AcylCoA_DH_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: ABX35953
UniProt: A9BZP5
Position
3636943..3638880
Genome map
AA seq 645 aa AA seqDB search
MAATACSRYSCWPHALPLAAPAASFLIPDITMRLRSTIDFLLYEWLRADALGERERFADH
SRDTFDAVLDTCERIAREKYAPFNRTVDTQEPQFDGEKVILPQCTHDARQAYADSGMLSA
AQDYDIGGMQLPYTVEAAANSFFAAASISIGSNMLTSGNANAIMAHGTDMQKQVFATNEF
NGRWAGTMCLSEPQAGSSLSDIATRAEPDGADFESDALGPRYRLKGNKMWISAGDHELTE
NIVHLVLAKIPGPDGKPVPGVKGISLFIVPKKLVDTEGQLTGERNDVALAGLNHKLGWRG
TTNTLLNFGEGRFPVRGGAGAVGYLVGKPGEGLKCMFHMMNEARISIGMAATMLGLAGYH
ASLDYAQNRPQGRPIKGAPGAAGKDATRPQSRIIEHADVKRMLLAQKSYCEGALALNLFC
ARLVDEQHTGTPESVAEARLLLEVLTPISKSWPSEFCLEANSLAIQIHGGYGYTRDFPVE
QYWRDNRLNMIHEGTHGIQAMDLLGRKVLMEGGKGLQLLATRVNDTIQRAMARPELAGHA
NELAKALQEVGATTKAAWATDDPQQALANAVPYMQAFGHTVLAWTWLDVSLAVLAKDAAL
AEPANAGRMAAMRYFFGYELPKIGAWLKVVRERDMTCAQMSEEAF
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccaccgcctgttcccgttactcctgttggccgcacgcgctccctctggcggcg
cctgcggcttcttttttgattccggacatcaccatgcgcctgcgttccaccatcgatttc
ctgctctatgaatggctgcgcgccgatgcgctgggcgagcgcgagcgctttgccgaccat
tcgcgcgacaccttcgatgccgtgctcgacacctgcgagcgcatcgcccgcgagaaatac
gcccccttcaaccgcaccgtggacacgcaggagccgcagttcgacggcgagaaagtcatc
ctgccccagtgcacccacgatgcgcgccaggcctatgccgactcgggcatgctcagcgcc
gcccaggactacgacatcggcggcatgcagctgccctacaccgtggaggcggcagccaac
agcttcttcgcggcggcctccatcagcatcggctccaacatgctgacctcgggcaatgcc
aacgccatcatggcccacggcacggacatgcaaaaacaggtctttgccaccaatgaattc
aatggccgctgggccggcaccatgtgcctgtccgagccccaggccggctcgtcactgagc
gacattgccacccgtgccgagcccgatggcgccgacttcgagagcgatgcgctgggtccg
cgctaccgcctcaagggcaacaagatgtggatcagcgcgggcgaccatgagctgaccgag
aacatcgtccacctcgtgctggccaagatccccggccccgatggcaagcccgtgcccggc
gtcaagggcatctcgctgttcatcgtgcccaagaagctcgtggacaccgaaggccaactg
accggcgagcgcaacgacgtcgccctggccggcctcaaccacaagctgggctggcgtggc
accaccaacacgctgctgaacttcggggaagggcgctttcccgtgcgcggcggcgccggg
gccgtgggctacctggtcggcaagcccggcgagggcctcaaatgcatgttccacatgatg
aacgaggcccgcatctccatcggcatggccgccaccatgctgggcctggccggctaccac
gccagcctggactatgcgcagaaccgcccgcagggccggccgatcaagggggcgccgggt
gcagccggcaaggatgccacgcgcccccagtcgcgcatcatcgagcacgccgacgtcaag
cgcatgctgctggcgcagaagtcctattgcgaaggcgcgctggcgctgaacctgttctgc
gcgcgcctggtcgatgagcagcacaccggcacgcccgaatccgtggccgaggcacggctg
ctgctggaagtgctcacccccatctccaagagctggcccagcgagttctgcctggaggcc
aactccctggccatccagatccacggcggctacggctacacgcgcgactttcccgtggag
caatactggcgcgacaaccgcctgaacatgatccatgaaggcacgcacggcatccaggcc
atggacctgctgggccgcaaggtgctcatggaaggcggcaagggcctgcagctgctggcc
acgcgcgtcaacgacaccatccagcgcgccatggcccggcccgagctggccggccacgcc
aacgaactggccaaggccctgcaggaagtcggcgccaccaccaaggccgcatgggccacc
gacgacccgcaacaggccctggccaatgccgtgccgtacatgcaggccttcggccacacg
gtactggcctggacctggctggacgtgtccctggccgtactcgccaaggacgccgccctg
gccgaacccgccaacgctggccgcatggccgccatgcgctacttctttggctacgagctg
ccgaagatcggcgcctggctcaaggtcgtgcgtgagcgcgacatgacttgcgcgcagatg
agtgaagaggcgttctga

DBGET integrated database retrieval system