KEGG   Delftia acidovorans: Daci_3508Help
Entry
Daci_3508         CDS       T00620                                 

Definition
(GenBank) Trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Daci_3508
Enzymes [BR:dac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     Daci_3508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_12 Methyltransf_23 MTS FtsJ NodS Methyltransf_4 PCMT Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: ABX36144
UniProt: A9BWC4
Position
complement(3854881..3855654)
Genome map
AA seq 257 aa AA seqDB search
MTWSAKQYTTFEQERTRPVRDLVAAIPDLPGRAVRLAVDLGCGPGNSTEVLAQRFPGATV
TGLDNSEDMLDAARKRLPGTAFSLADIATWQPDQPQDVILANASLQWLPDHQQLYPRLVS
HLAPGGSLAVQTPDNLEEPAHRLAREVAASGPWAATIGDVRHPARHSADFYYALLRPHCS
NVDVWRTTYFHPLAGSHAAVVEWFKGSALRPFVAPLDEEQKAGFYAAYLQAISQAYPALD
DGTVLLPFPRLFIVASR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacctggtccgcaaagcagtacacaacgttcgagcaggaacgcacgcgccccgtgcgc
gacctggtggccgccattcccgacctgcctggccgcgccgtgcggctggctgtggacctg
ggctgcggccccggcaactccaccgaggtcctggcccagcgcttccccggggccaccgtg
acgggactggacaattccgaggacatgctggatgccgcacgcaagcggctgccgggcacg
gccttctcactggccgacatcgccacctggcagcccgaccagccgcaggacgtgatcctg
gccaatgcctcgctgcagtggctgcccgaccaccagcagctttacccgcgccttgtcagc
cacctggcacccggtggcagcctggccgtgcagacgccggataacctggaagaaccggcc
caccggctggcgcgggaggtggccgccagcggcccctgggccgccacgattggagatgtg
cgccaccccgcacggcacagcgcggacttctactacgccctgcttcgcccgcactgcagc
aacgtggatgtctggcgcaccacctacttccacccgctggcgggcagccatgccgcggtg
gttgagtggttcaagggttcggcgctgcgtcccttcgtcgcgccgctggacgaggagcaa
aaggccggcttctacgcagcgtatctgcaggccatctcccaggcctaccccgcgctggac
gatggcacggtgctgctgcccttcccaaggctgttcatcgtggccagccgctga

DBGET integrated database retrieval system