KEGG   Delftia acidovorans: Daci_3590Help
Entry
Daci_3590         CDS       T00620                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
dac  Delftia acidovorans
Brite
KEGG Orthology (KO) [BR:dac00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dac03036]
    Daci_3590
Chromosome and associated proteins [BR:dac03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    Daci_3590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_21 AAA_15 AAA_23 SMC_hinge AAA_13 AAA_29 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABX36224
UniProt: A9BZW2
Position
3942698..3946312
Genome map
AA seq 1204 aa AA seqDB search
MARGIIPSFPVVPPRPHSSVRRGPPSACIVRLNSIKLSGFKSFAEPTNFMLPGQLVGVVG
PNGCGKSNIMDAVRWVLGESKASELRGESMQDVIFNGTTHRKPASRSSVELVFDNSDHRA
GGQWGQFGEIAVKRVLTREGNSSYFINNQAVRRRDVQDVFLGTGLGPRAYAIIGQGTISR
IIESRPEELRLFLEEAAGVSKYKERRRETENRLSATTENLTRVEDILRELNNNLDRLEKQ
AEVAAQYNALQSQVTLKQQQLWFLKRAEAEAEQDRVRVEGLQAVNELEERMADIRNNESG
LETLRQAHYDASDQVNQAQAKLYESTAEVGKLEAEIRYVLEGRQRVQQRLQQLSEQVLLW
NSRREEAEAEIENLEGAGMDAEEQAEMLAAQVEEQSMRLPDLEDALRNAQKADTDQRASV
VQVQQQIQVLAAEQRSLDEQRRQFETRFERLRADRNALETPDEARLNNLQSQLQEARELA
EMADAVLNELQDSVPQLDEDRRTRQQAVNAEAARHADLSARLEALKALQEKVKTDGKLQP
WLAKHGLDGMQGLWSRIAIEPGWENALEAALRERLGALEVGRLDMVRGFLGSGGHDAPPA
RLAFFSPPQGAPAPAAGRWQHLSDLLRVNDAGLRAVLGDWLQDCYTAPTLEEALSRRSEL
RPGETVYVPTGHAVSSHSVSFYAQDSEQSGLLARAQEIEHLEKEVRAQALISDESRTALV
RAESAYAEASQRLVSARREASESQSRAHELQVETLRLSQLAEQARARNAQISADLAEVEA
QLSDIEERRVAAEARFEELDMQLADSQERHAQLGDKVLESERRLNESREQLRTLERQAQE
ATFSRRSLEARRGELSRTIETASQQARSLADEQQRAQDELTRLTDAAAQGGLQDALDLKM
QREQAVAARRSEYDDLTNKLRASDERRQQLEKALDPLRQRITEFQLKEQAARLGLEQYST
LLEEAGADLAAVSQSIAEANVRMHGLQGEIDRLHREIAALGAVNLAALDELKLARERKTF
LDAQTEDLTQAMNTLEDAIRKIDAETRELLSGTFETVNGHFGRMFPELFGGGQAKLVITG
DEILDSGVQVIAQPPGKKNQTIHLLSGGEKALTAIALVFAIFQLNPAPFCLLDEVDAPLD
DANTERYAKLVASMSKSTQFLFISHNKIAMEMAQQLIGVTMQEQGVSRIVAVDMESALSM
AELS
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcggtatcattccgagcttccctgttgttcccccacgtcctcattcgtccgtt
cgccgcggaccgccatctgcctgcatcgtgcgcctgaattccatcaagctgtccggcttc
aagtccttcgccgagcccaccaacttcatgctgccggggcaactggtgggcgtggtgggc
cccaacggctgcggcaagtccaacatcatggatgcggtgcgctgggtgctgggcgagagc
aaggccagcgagctgcgcggcgagtccatgcaggacgtgatcttcaacggcaccacgcac
cgcaagccggccagccgctccagcgtggaactggtgttcgacaacagtgaccaccgcgcg
ggcggccagtggggccagttcggcgagatcgccgtcaagcgcgtgctcacgcgcgagggc
aacagcagctacttcatcaacaaccaggccgtgcgccgccgcgatgtgcaggacgtgttc
ctgggcacgggcctgggcccgcgcgcctacgccatcatcggccagggcacgatcagccgc
atcatcgagtcgcgccccgaggaactgcgcctgttcctggaagaggccgcaggcgtgtcc
aagtacaaggagcgccggcgcgagaccgagaaccggctctcggccaccaccgagaacctc
acgcgcgtggaagacatcctgcgcgagctcaacaacaacctcgaccggctggaaaagcag
gccgaggtggcggcccagtacaacgcgctgcagtcccaggtcacgctcaagcagcagcag
ctgtggttcctcaagcgcgccgaggccgaggccgagcaggaccgcgtgcgcgtggagggc
ctgcaggccgtcaacgagctcgaagagcgcatggccgacatccgcaacaacgaaagcgga
ctcgaaaccctgcgccaggcccactacgacgccagcgatcaggtcaaccaggcccaggcc
aagctctacgaatccacggccgaagtcggcaagctggaggccgagatccgctacgtgctc
gaaggccgccagcgcgtgcagcagcggctgcagcagctgtccgagcaggtgctgctgtgg
aacagccgccgcgaggaagccgaagccgagatcgagaacctcgaaggcgccggcatggac
gccgaggaacaggccgagatgctggccgcccaggtcgaggagcaaagcatgcgcctgccc
gacctggaggacgccctgcgcaatgcccagaaggccgacaccgaccagcgcgccagcgtg
gtccaggtgcagcagcagatccaggtgctggccgccgagcagcgcagcctggacgagcag
cgccgccagttcgagacccgcttcgagcgcctgcgcgccgaccgcaacgcgctggagacg
cccgacgaggcccgcctgaacaatctgcagtcccagctgcaagaggcgcgcgaactggct
gaaatggccgatgccgtgctcaacgagctgcaggactccgtgccccagctcgacgaggac
cgccgcacgcgccagcaggccgtcaatgccgaggccgcgcgccacgcggacctgtcggcg
cggctggaagcgctcaaggccctgcaggaaaaggtcaagacagacggcaagctccagccc
tggctggccaagcacggcctggacggcatgcagggcctgtggagccgcattgccattgag
cccggctgggaaaacgcgctggaggccgcgctgcgcgagcgcctgggcgcgctggaagtg
ggccggctcgacatggtgcgtggctttctgggctcaggcgggcacgatgcgccgcccgcg
cgcctggccttcttcagcccgccgcagggcgcacccgcgccggccgccggccgctggcag
cacctgtcggacctgctgcgcgtgaacgatgccggcctgcgcgccgtgctcggcgactgg
ctgcaggactgctacacggcgcccactctggaagaggcgctgtcgcgtcgcagcgaactg
cggcccggtgaaaccgtctacgtgcccacgggccatgccgtcagcagccacagcgtgagc
ttttatgcgcaggactcggagcaatccggcctgctggcccgcgcccaggaaatagagcac
cttgaaaaggaagtgcgcgcccaggcgctgatttccgatgaatcacgcacggccctggtg
cgtgccgaaagcgcctatgccgaggcctcgcagcgcctggtcagcgcccggcgcgaggcc
agcgaatcgcaaagccgtgcccacgagctgcaggtcgagacgctgcgcctgtcgcagctg
gccgagcaggcccgcgcgcgcaatgcccagatcagcgccgacctggccgaggtcgaggcc
cagctgtccgacatcgaggagcgccgcgtggcggccgaggcccgcttcgaggaactggac
atgcaactggccgacagccaggagcgccatgcccagctcggcgacaaggtgctggagtcc
gagcggcgcctgaacgaatcgcgcgagcagctgcgcacgctggaacgccaggcccaggag
gccacgttctcgcgccgcagcctggaagcgcgccggggcgaactcagccgcaccatagag
acggccagccagcaggcccgctcgctggccgacgagcagcagcgcgcgcaggacgagctc
acgcgcctgaccgatgccgcggcccagggcggcctgcaggatgcgctggatttgaagatg
cagcgcgagcaggccgtggccgcgcgccgcagcgaatatgacgacctgaccaacaagctg
cgcgccagcgacgaacgccgccagcaactggaaaaggcgctggacccgctgcgccagcgc
atcaccgaattccagctcaaggagcaggccgcgcgcctgggcctggagcagtactccacc
ttgctggaagaggcgggcgccgacctggccgccgtctcccagtccattgccgaggccaat
gtgcgcatgcacggcctgcagggcgagatcgaccgcctgcaccgcgagatcgcggccctg
ggcgcggtcaacctggcggcgctggacgagctgaagctggcgcgcgagcgcaagaccttc
ctcgacgcgcagaccgaggacctgacccaggccatgaacacgctggaagatgccatccgc
aagatcgatgccgagacgcgcgagctgctgtcgggcaccttcgagaccgtgaacgggcat
ttcgggcgcatgttccccgagctgttcggcggcgggcaggccaagctggtcatcacgggc
gatgaaatcctggactcgggcgtgcaggtgatcgcgcagccgcccggcaagaagaaccag
acgattcacctgctgtcgggtggcgagaaggcgctgaccgcgattgccctggtcttcgcc
atcttccagctcaacccggccccgttctgtctgctggacgaggtggacgcgccgctggac
gacgccaacaccgagcgctatgccaagctggtggccagcatgagcaagagcacgcagttc
ctgttcatcagccacaacaagatcgccatggaaatggcccagcagctcatcggcgtgacc
atgcaggagcagggcgtgtcccgcatcgtggccgtggacatggagtccgcgctgtccatg
gctgagctatcctga

DBGET integrated database retrieval system