KEGG   Delftia acidovorans: Daci_3829Help
Entry
Daci_3829         CDS       T00620                                 

Definition
(GenBank) CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
dac  Delftia acidovorans
Pathway
dac02020  Two-component system
dac02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dac00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Daci_3829
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Daci_3829
Enzymes [BR:dac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Daci_3829
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Daci_3829
Two-component system [BR:dac02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Daci_3829
Bacterial motility proteins [BR:dac02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Daci_3829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: ABX36460
UniProt: A9BLH5
Position
complement(4217784..4218398)
Genome map
AA seq 204 aa AA seqDB search
MPATTNTPASDAATAYEAIVIGGSAGALDALSAVLPTLPASLRASVLVVLHLPRDRRSLL
GQLFGPRCALPVREVQDQQWLEPGCLYFAPADYHLLVDSGPRLALSLDAPWHFSRPSIDV
LFESAADCYGERLLAVLLSGANEDGAQGMASVHAAGGLAVVQSPDSAAMQTMPRAALARV
PQAQVLAPQGIAALIASLHGQGRL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgaccacgaacacacccgcctccgacgccgccacagcctacgaggccatcgtg
atcggcggctcggccggcgcgcttgatgcgctgtccgcggtgctgcccacgctgcccgcc
agcctgcgcgcttcggtgctggtggtactgcacctgccgcgcgaccggcgcagcctgctg
ggccagcttttcgggccgcgctgcgccctgccggtgcgcgaggtgcaggaccagcaatgg
ctggagccgggctgcctgtactttgcgccggccgactaccacctgctggtggacagcggt
cccaggctggcgctgtcgctggatgcgccctggcatttttcgcggccctcgatcgatgtg
ctgttcgagtcggctgccgactgctatggcgagcgcctgctggccgtgcttctgtccggc
gccaacgaggatggcgcccagggcatggccagcgtgcacgcggccggcggcctggccgtg
gtgcagtcgccagacagtgccgcaatgcagaccatgccgcgggcggccctggcccgcgtg
ccacaggcccaggtgctggcgccgcagggcattgccgcgctcatcgcatcgctgcacggc
caggggaggctttga

DBGET integrated database retrieval system